Detailed information on CNT30693516


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553784Oryza sativaOryza glaberrima92.0949.2399.28699forward
CNT30108234Oryza sativaOryza longistaminata60.8748.0793.94462forward
CNT30576369Oryza sativaOryza barthii92.0938.999.57699forward
CNT30116872Oryza sativaOryza nivara92.2374.6399.43700reverse complement

Expression of CNT30693516

Peptides detected in this lncRNA

>peptide 1 (61 aa)
TFAHFLSPYSLPLPSPQSLLHEPPPPPPQPLISPYVVPPPSRWCLGMLPINNSLSSSAYCC*

>peptide 2 (29 aa)
MDSEVAATGGSSASGVWCSHEQIRQQQGL*

>peptide 3 (37 aa)
MSLSRMDLGMVSGIEALPSELWQRAEFSTMMAARCCD*

>peptide 4 (50 aa)
VRSLPLPLLSPSPISPIPAPRATTASATTPHLPLRRASSLSMVPWHAPNQ*

>peptide 5 (53 aa)
RSLTSSPPTLSLSHLPNPCSTSHHRLRHNPSSPPTSCLLPLDGALACSQSIIP*

Sequence

>CNT30693516
ACGTTCGCTCACTTCCTCTCCCCCTACTCTCTCCCTCTCCCATCTCCCCAATCCCTGCTCCACGAGCCACCACCGCCTCCGCCACAACCCCTCATCTCCC
CCTACGTCGTGCCTCCTCCCTCTCGATGGTGCCTTGGCATGCTCCCAATCAATAATTCCTTGAGCTCGTCGGCATACTGCTGTTAACGACCAGCATCAAC
AACTGCATGGATTCGGAGGTGGCAGCAACAGGCGGATCGAGCGCTAGTGGTGTTTGGTGCTCTCACGAGCAAATCCGGCAACAGCAAGGGCTCTAGCAGG
CGGATCCAGCGGTGGGTGCTCTTGCGAGCACATCCGGCAGTAGCAAGGGCTCTAGCAGGCGGATCCAGCGGTGGGTGCTCTCGCAGGCCGATCCAGTGGC
GGCAAGGGCTCTCACGGCGGTGGCGGCGGGTGCCATCGTGGGCTGATCTGGTGGCAGCAAGGGCTCTAGCAGGCGGATCCAGCGGCGGCAAGGGCTCTCG
CGGCGGCGGGTGCTCTTGCGGGCAGATCCAGCAGTGACAATGACTTGTGGGCGGATCCAGCGATGTCGCTCTCTCGCATGGACCTAGGGATGGTAAGCGG
CATCGAAGCCCTCCCCAGCGAGCTATGGCAACGGGCGGAGTTCTCCACTATGATGGCGGCTAGGTGTTGCGATTAGTGTATTGTGTGTTGATTCTATGAT
GATGTGCTTGTGTACTTCGGTTCTCGGATGTTGAGCGATGAATGTTCGATTGTGACGTG