Detailed information on CNT30693451


BLAST search results

BLAST vs Swiss-Prot:
sp|C0LGD7|Y1684_ARATH, E-value = 1e-93

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30106844Oryza sativaOryza longistaminata6.6921.5210048forward
CNT30604142Oryza sativaOryza punctata6.6921.5293.7548forward

Expression of CNT30693451

Peptides detected in this lncRNA

>peptide 1 (36 aa)
LSHYVFTMLNRLHPGQQFKKNNPKAVHITFIRQFMS*

>peptide 2 (35 aa)
TSLTMFLPCSIGFIPVNNSRKTTPRLYTSLLSVNL*

>peptide 3 (33 aa)
MHLFIFFITVTNQRNQIAMMQSRQQLYFCAKLC*

Sequence

>CNT30693451
ACCTCTCTCACTATGTTTTTACCATGCTCAATAGGCTTCATCCCGGTCAACAATTCAAGAAAAACAACCCCAAGGCTGTACACATCACTTTTATCCGTCA
ATTTATGAGTTAGGAAGTATTCTGGATCAAGATACCCCTGCCAAAGGGTGCCCTTAACAACGGTGGAGACATGAGCTGGTAAAGCCCCTTCAACATCTGG
TACTGGAGCAAGCCTCGAAAGACCGAAGTCAGCTACCTTGGCGACATATTTAGAATCCAACAAAATATTGCTGGCCTTAACATCACGGTGAAATATAGGA
GGATCTGCATCGGTGTGGAGATACAGAATTCCCTTTGAAGCACCCAATGCAATGTGCAGCCTCAAACCAAAACCGAGAGCCATGTGCTTACCAGAAAGAT
GATCACGTAAAGTGCCATTCGGCATGAATTCATAAACTAGCATCTATGCACCTGTTCATTTTCTTCATCACAGTAACCAACCAACGCAACCAGATTGCGA
TGATGCAATCTAGACAACAGCTCTATTTCTGTGCAAAACTCTGTTGAACCTTGAAGAGAATCCTCGTGTGCCCTTTTGATTGCAACAATTGTTCCATCAG
CTAGAATTCCTTTATAGACTATTCCATAACCTCCTTGACCAACTTGAGCTGACATATCAAAATTATTTGTAGCAGAAGCCATTTCTTCATATGTGAAGCA
TCTGACCCCATCAATTTT