Detailed information on CNT30693252


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT002177, E-value = 8e-149

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30370705Oryza sativaOryza glumipatula50.9711.1389.87158reverse complement

Expression of CNT30693252

Peptides detected in this lncRNA

>peptide 1 (33 aa)
RTLKVDDDFITSLCVYKVHQQHSLQKFRLNSKP*

>peptide 2 (29 aa)
KELLKWMTTLLLLSVFTKCTNSTPYKNFD*

Sequence

>CNT30693252
AAAGAACTCTTAAAGTGGATGACGACTTTATTACTTCTCTCTGTGTTTACAAAGTGCACCAACAGCACTCCTTACAAAAATTTCGACTAAACTCGAAACC
CTAACTCAAAACTCAACTCAATTGCTCTCAAAAGCGATACCGGGAAGCCTCACGCTCCCCCTCTATTTATACCCGAGGTAGGCAGCCTAAAGCCACGAAC
CAAACTCATACTAGGAGTCCTAAACACCTTAGGAAACCCTCTAGTACAAGAAAGAAACTTTAGATAACCAATCGTACCAAATTTGGACTGCTTCCAAATT
CGACTCCGCA