Detailed information on CNT30693070


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT000678, E-value = 2e-80

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30693070

Peptides detected in this lncRNA

>peptide 1 (71 aa)
MGSIGRSTCAIAGNHRSTSSIGCAAAGSTGAASRSTCAVIGSRRLRRRSTCATARSTGATRFPPPVHLYLG*

>peptide 2 (39 aa)
MKIWAGQKEHCDHVPHVRIKLPSDNLNACSDPRRRRNQP*

>peptide 3 (39 aa)
MFYHLATIKIRIIKKFHIRRAVKVGHANPGFTFFFGRRE*

>peptide 4 (41 aa)
MYLKFCTFGTESALEVGFLIWLGTLYKLDSHFVQLIKEYGLS

>peptide 5 (54 aa)
MRPPLPAAASYATTPPPSSHLSSARSAPPWSPSQTFLPVHRLRLRRRRPTQEQD*

>peptide 6 (30 aa)
MIFSVMHLLTRLQILHVLQLMYEYTFLKKR*

>peptide 7 (33 aa)
MWMFLEPTVDYTIDLALIPQIKKTVALRASSIV*

Sequence

>CNT30693070
GTCTTTTAAGTGGGCGATAATCTGTACACGGTGGCAAAAGTAATGATCTGGAGAAGAAATTAGTGGAGAGAGAGTGAAAGTGGGCGACTAATTTATCGTG
AGCAGCAGAAAAAGTTAGATTAAAATATTGAAAAATAATACTACCTCCGTCCCAAAATAAGTGCAGTCACAAGTTTCCGCGCCTAACTTTGATCGTCCGT
CTTATTTGAATTTTTTTATAATTAGCATTTTTGTTGTTATTAGATGATAAAACCATGAATAATACTTTACTCGTGACTTATATTTTTAATTTTTTTAATT
TTTTTTAAATAAGACGAATGATCAAAGTTAGGCGCGAAAAACCATTGTATTGCTGATGTGGATGTTTTTGGAGCCAACCGTGGACTATACTATTGACCTT
GCTCTTATTCCCCAAATAAAGAAAACAGTGGCTCTTAGAGCAAGTTCAATAGTATAGCTAACTAATAGCTCCAATTCATCTATAGCCAATCTAATAGTTC
ATTCATACAATAATTACATACTATACTATTAATACTAGTCCCACCTATCATAGACACACTACGTCTTAGAGTCTGTGCTACAGCTGACTACAAATATGTA
CTCCCTCCGTCCCAAAAAAAGACAAACCCTGGTTTCCGTGCCCAATGTTTAACCATCCGTCTTATTTGAAAAAATTATAAAAAAAATTAAAAAGACAAGT
CACACACAAAGTATTAATCATGTTTTATCATCTAGCAACAATAAAAATACGAATTATAAAAAAATTTCATATAAGACGGGCAGTCAAAGTTGGACACGCA
AACCCAGGGTTTACCTTTTTTTTTGGACGGAGGGAGTAGTCCGCTGCTCTTCTCTCTCCTGATTTATCTATACTAATATAAAAAGTACGAGCTCATCCAC
AATCCAGCAATCCTGCAGATCCGCTATCACGTGGGACCCACCTGTCATCCGGACAAAGAAACCGCACAGACCACGTCGCGCACGGAAAAAAATTTCGCCA
AAAAAAAAACTGCTTCCATTTCGCAAAAAAAACTGCCTCCCCTTCTCCTTCGCACGCGTCCTCCGCAACGCTAATCACGCGCCTGGTCCGTCGGCGCCGC
CGCCGCACGCCCGCCCGCCGGAGCCGCTCACCCTACCCCGTCGCCGCCTCGGATCCGCCTGTGGCCGCCGTCTCCCGCCGGAGCCGCCTCCTACGCCACC
CATCGCCGCCTCCTATGCGCCCGCCGCTTCCCGCCGCCGCCTCCTACGCCACCACCCCTCCGCCGTCGTCGCATCTGTCCTCAGCCAGATCGGCGCCACC
GTGGTCGCCGTCACAAACATTCCTCCCTGTCCACCGCCTCCGCCTCCGCCGCCGACGCCCCACCCAGGAGCAGGATTGAGAACGAGAAGACAACTTTCGA
TTCGTCTGTTCTCGAGATGAGGGACACGTTGACCTGAAATTTTACCCACTCTGACCTCCTCCATCGGCTGCGCTGTTGCTCAACCTACGCCACCGCCGGA
TCGATGGGATCCATTGGCCGCTCCACCTGCGCCATCGCCGGGAACCACCGATCGACCTCCTCCATCGGCTGCGCAGCTGCCGGATCGACGGGAGCCGCCA
GCCGCTCGACCTGCGCTGTCATAGGGAGCCGTCGGTTGCGCCGCCGCTCCACCTGCGCCACCGCCAGATCGACGGGAGCCACCCGCTTTCCCCCTCCCGT
GCACCTCTACCTGGGATAAATTGATTGAGCAGCTTCAAAGCAGACGCCTCCCTCCGCATCTCCGTTCCGCTCTCTCCCCTTCGACCACCTCCACCACCAT
CGCACGCCGCATCGCCTCTCCAATCTCTCCCCGGTGGCTGCGAATCAATCCCAGCTGGATAACACTCATCCCTCATGCCATCTACCTCTCCAGTATAATA
TACTTCTAGGCATATGATTTTCTCGGTGATGCATTTATTAACACGATTGCAGATACTGCATGTGTTGCAGTTGATGTATGAGTATACTTTCCTGAAGAAG
AGGTAGCTGATTTGTGTAGTTCACACAACATAAGCAGCAGTTGTCTAATCCCTTGGATAAAACCATATCAACTACATGAAGATCTGGGCAGGACAGAAGG
AACACTGTGACCATGTCCCCCATGTACGCATCAAGCTCCCAAGTGATAATCTGAATGCCTGCTCAGATCCTAGGCGCCGGCGGAATCAACCTTGACCCAT
CAATGATGGTCATCCCCCATTGACGATCACATGGTCCATAGAGACCATGGTGTCTGATTTTTGACGGTTTAAGCTTTGTCTACACTTTTTCTTTCTCAGC
ATTTGCTTCTGATGGTTTATACTTTAGAGTTGGGTATTGGATGTTCATTCTCTAGATGAATTGGTCATGTACTTGAAATTTTGCACATTTGGTACTGAAT
CTGCACTCGAAGTGGGTTTCCTAATTTGGTTAGGTACATTGTATAAGCTAGATTCGCATTTTGTACAATTGATTAAAGAATATGGTTTGTCT