Detailed information on CNT30692950


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553534Oryza sativaOryza glaberrima41.7559.2995.291209forward
CNT30596145Oryza sativaOryza meridionalis39.349.9194.991138reverse complement
CNT30101375Oryza sativaOryza rufipogon23.9381.34100693forward
CNT30117659Oryza sativaOryza nivara39.326.9594.381138forward

Expression of CNT30692950

Peptides detected in this lncRNA

>peptide 1 (82 aa)
MRDVGPDLPIGIDKQSIWAESRHNSIRLLNEHATEPRNRSTTFPLVINRAETRLTSPRRLILACESKNTDKNKIDCNTIAYE*

>peptide 2 (41 aa)
MIKEVDWGPNQDLLQVYFYPTTSLFVHRKQEIKFYTFWIWI*

>peptide 3 (59 aa)
MLIFLLLIVLVGGRNWYITTINSGGQGQSGGNTMSFVCVRLQRYLLGRRKRGRASRMHG*

>peptide 4 (34 aa)
MQLCCNLSCSCLCFSIRMQGLAFSARSTGFRHSW*

>peptide 5 (40 aa)
MKSTFISFWSHVKIPTELPGICKTNHTPHLVRILFGFWAL*

>peptide 6 (29 aa)
MCDRAAFAPAPTERKMKQQASNTCLIAIR*

Sequence

>CNT30692950
GCCAAGTGAACACTGCATATATATTAGTGTTAGTGTGCTACATATATATAGCAAGTGATGTGTGATAGAGCTGCATTTGCACCTGCACCTACAGAGAGGA
AGATGAAGCAGCAAGCTAGCAATACGTGCTTGATCGCTATACGCTAGCTTCTTGCACACAATGTTGTTCCTGGTCTCTTCCTGATCCCTAGGTGCAGAGG
CAGATGCAACTATGTCATAGACTTCACATCCATCTTTAGTTACTTACCACTATATATTCAATAAATTAGCTAGCACCCTAGTTCTCTTGCTGATTCCTTT
CAAAAAATCTTCAGTTACTTGCTCCTTCTAATCCTTTTTTATTAGTTATTTCACTCCATGAAGTTTCAATCAATGAGCATGCAGCTAGCTAAATAATTTT
GATGATATAGATTATTCTATCATATATTACCCATGAACATGCACAACACAAGTGAATAAGCTACATAACAAAAGAGAAAAAACTCAAAAAAAAATATATA
TTAAATCATATGTTTCCGAAGGATGATGATATACGAATTTGCATATAACCGGAACAATATATCAAAGTTTATGGTTTTCTTTTTTACGATATAAATACTT
TCTTTTATGATTATAAGGTAATCTATTGTCCTTATAGTGAATATGTGAATTTGGTGAGATATGCCTTCTTTAATATTCTTTATATAAACAATAAATAAAT
TGTCGGTGCATCTACACGGACTTACTTCCTAGTTAATTTAATCTATAGAAATTCATAAATTTTAAAATCATGAGATTTATATTTTTAGATTCATCATGAG
AAATATACTTCGGTATATATCATTCACATGTTACTAAACTATATGAATTTATAGAAAAAGGTTATAAAGAATAAAAATATTTAACTGACTTTCGACAAAT
CTGAAACGACAAGTAATTTGAAATGGATGTAGTCATCACAATCCAACTCTAGTTAATTATTAAATTGCATGTCTATTTCATTTCTCCTTCACTTTGGTGT
ATAATTCTTGCATCAACATTAGTTCTCCAATCCTAATATAACTACATTATTTATTATTGGTATGCGTGTAAGAAATGCTAATTTTCCTTTTATTAATTGT
GCTAGTTGGTGGTCGAAACTGGTACATAACAACCATCAATAGCGGGGGGCAGGGTCAGAGTGGCGGCAACACAATGAGTTTTGTGTGTGTTCGTTTGCAG
AGGTACTTGCTTGGACGAAGGAAAAGAGGGCGAGCATCACGAATGCATGGATGATCAAAGAGGTTGATTGGGGACCAAACCAAGACCTTCTCCAAGTATA
CTTCTACCCCACCACGTCACTTTTTGTCCATAGAAAACAAGAGATAAAGTTCTACACGTTTTGGATTTGGATTTAGGCCTCCTGACAGCATCAACTTCAA
ACTTCGGGGCTCCTGACCTAGCCACTGATCTAGAAGGAATTTCGGGGCCCATGAGTACTTGTTGGAAAGCTTATGAAGTCTACTTTCATATCGTTTTGGT
CCCACGTCAAAATTCCTACTGAGCTGCCAGGAATCTGCAAAACAAACCACACACCTCATCTAGTCCGAATCTTATTTGGGTTTTGGGCCTTGTAATTGTG
TCGTGGGCTTAGCCCAAGGACATCCCTAATCATACTTAATCAGTAGCCGTCATTGTTTAGAGTCGGGTTTTGCTTAGATTATTCTGTCAAGAATAGTTTC
GCCGCTAGATCGGTTTGTAGAACCCTAAATTCGAGTGCTTAATCATTCATATGCAATTGTGTTGCAATCTATCTTGTTCTTGCTTGTGTTTTTCGATTCG
CATGCAGGGATTAGCCTTCTCGGCGAGGTCAACCGGGTTTCGGCACAGTTGGTAACCAGAGGAGACGTGGTGCTGCGATTGCGGGGCTCAGTAGCGTGTT
CGTTCAGAAGCCGGATCGAGTTGTGTCGCGACTCCGCCCAAATCGACTATTTATCAATACCCGTCTGAAAGTAGACCCCATAAGCTTTCCATCAAGTACT
CATGGGCCCTGAAATTCCTTCTAGATCAGCGGCTAGGTTCGTTTGAAGTTGATGCTGTCAGGAGGTCCAAATCCAAATCCAAAACGTGTACAACTTGATC
TCTTGTCTTCTATGGGCCAAAAGTGACATGGTGAGGTAGAAGTAGATTTGGAGAAGGTCTTGGTTTGGTCTTGATTCCGTTTTTATACTTTTCAGAAGTT
TTTGTCGGTCGAGTTTGGAGTTGCGGCTAGGGTTTGCCAGTGCTTCTGCCGAATTTTCCTTTGGCCGAACCCCTCCCCACACGCGACTGCCGCCTCCACC
TCAAGGCCGACTGCCACCTCCACCTCACGGCAAATTCTTCCGTGCCGCTTCCTCAATTATCAGATTATTAGGTATTTTGGTGGTTGTAGATTTGAGATAT
TTTTAACTGATGAGGGATGTAGGTCCCGATCTTCCGATAGGTATTGATAAACAGTCGATTTGGGCGGAGTCGCGACACAACTCGATCCGGCTTCTGAATG
AACACGCTACTGAGCCCCGCAATCGCAGCACCACGTTTCCTCTTGTTATCAACCGTGCCGAAACCCGGTTGACCTCCCCGAGAAGGCTAATCCTTGCATG
CGAATCGAAGAACACAGACAAGAACAAGATAGATTGCAACACAATTGCATATGAATGATTAAACACTCGAATTTGGGGTTCTACAAACCGATCTAGCGGC
GAAACTGTTCTTAACAGAATAATCTAAGCAAAACCCGACTCTAAACGATGACGGCTATTGATTAAGTATGATTAGGGACGTCCTAGGGTTGCCCTAGGGC
ACACACCCCCTTGGGCTAAGCCCACGACACAATTACAAGGCCCAAAACCCAAATCAGATTCGGACTAGATGAGGTGCATGGCTTGTTTTGCAGATT