Detailed information on CNT30692575


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30520760Oryza sativaSetaria italica16.1934.5890120forward
CNT30556855Oryza sativaPanicum hallii20.3823.3785.43151forward

Expression of CNT30692575

Peptides detected in this lncRNA

>peptide 1 (78 aa)
RRETFQHLFMIISVPPCTPDQPILSSIRSVFSSFRDLLLLHQLLSHFPVVLALVDHQGPTAAALPNHCSQSKHQLQSM*

>peptide 2 (55 aa)
MTTSHAPALSTRLPAAGMKRFEAYRTWREPCRPCRICDLLPEPRLPSAAGPPEMR*

Sequence

>CNT30692575
GAGGCGTGAGACCTTCCAGCACCTCTTTATGATTATCTCTGTGCCTCCTTGTACTCCTGATCAGCCCATCCTAAGCTCAATTCGGTCAGTTTTTTCTTCT
TTCCGAGATTTGCTGCTTTTGCATCAGCTTTTGTCACATTTTCCAGTTGTGTTAGCTCTAGTCGACCACCAAGGTCCGACTGCCGCAGCTCTCCCAAATC
ACTGCAGCCAGAGCAAGCACCAGCTACAAAGCATGTGACGGAGGGCAGTCATGTACTTCGTTCCCTTTGGAAGTCGATGAAGATTGCTACAGTGGGAAAG
GTTCAGCGTTTGCAGATGATATAGGATGCTTATGTCTTCAGGAAGTGCTTTAATTTCACTGCATGAGAGATCAAGATACCTCAGGATCTGAATTAGCCGG
ATTCCAATACCGAGATGACGACTAGCCATGCACCAGCATTATCGACAAGACTGCCGGCGGCGGGGATGAAGAGGTTTGAAGCGTACCGGACCTGGAGGGA
GCCGTGCCGCCCTTGCCGCATTTGCGATTTGCTGCCCGAACCGCGCCTTCCCTCCGCCGCCGGACCGCCGGAAATGCGCTGAGCCGCCCAAACCGCATCC
CTCGCTAACCCATACTCTCCCTCGGGGCTGAGCTTCTCGATGTACTCTCGTAATCTCAAATAAAAATTTCTGTCAGTCCTCTGTCAAGTAGTGTCCTGCT
CTGCTGTCATGAACTCTAGAATCTGAATTAGAAATTTGTCT