Detailed information on CNT30692499


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30278778Oryza sativaChenopodium quinoa24.3126.5682.58132forward
CNT30222738Oryza sativaHordeum vulgare18.4237.0490100forward
CNT30143198Oryza sativaLolium perenne29.2863.8694.34159forward
CNT30231412Oryza sativaAnanas comosus38.8659.186.73211forward
CNT30716030Oryza sativaMalus domestica golden17.6837.6589.5896forward
CNT30683328Oryza sativaTriticum urartu46.2262.7589.64251forward
CNT30721681Oryza sativaTriticum spelta26.3445.9890.21143forward
CNT30361937Oryza sativaSorghum bicolor48.2521.294.27262forward
CNT30595951Oryza sativaOryza meridionalis29.173.4998.1158forward
CNT30327267Oryza sativaAsparagus officinalis23.237.7290.48126forward
CNT3050887Oryza sativaCucumis sativus24.4946.6781.2133forward

Expression of CNT30692499

Peptides detected in this lncRNA

>peptide 1 (45 aa)
MSSSSLSSGVDGTDADGTVTVPAMISPSPSPWISRARRKRRRRRR*

>peptide 2 (81 aa)
PGVPLTRLDHLSRSIIVRDVKPQAVRDSSLGSLPEAEGVTTDKVSAFAVGIIQGVEEERGGRAEEMQEALGPRIRLMSLRL*

Sequence

>CNT30692499
TACCTGGAGTTCCTCTCACGAGGCTTGACCATCTGAGTAGGAGCATCATAGTCAGGGATGTTAAGCCACAGGCCGTGAGAGACAGCAGTCTTGGCTCCCT
CCCTGAGGCTGAAGGGGTAACCACGGACAAAGTCAGCGCCTTCGCGGTAGGGATCATACAAGGTGTTGAAGAAGAACGGGGTGGACGGGCTGAGGAGATG
CAGGAGGCCTTGGGGCCGAGGATCCGGTTGATGTCGTTGCGGTTGTAGAGCTCGTAGTCGAAGCCCTCGGGGACGCGGATGGTCTTGGTCGGGTCGCCGT
CCTGCACGATGATGAGGTGGTAGGGCTGGAAGAAGGGCCGCCACATCTCCAGGAAGTCCAGGTTGCGGATCGTCGGGATCACGATGTCCAGCTCGTCCTT
GAGCAGCGGCGTCGACGGCACCGACGCCGACGGCACCGTCACCGTCCCCGCCATGATCTCTCCCTCTCCCTCTCCCTGGATCTCGCGCGCGCGGAGGAAG
AGGAGGAGGAGGAGGAGGTGATGGTGGTGAGGTGTGAGGTGTG