Detailed information on CNT30692489


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT003442, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553012Oryza sativaOryza glaberrima86.5685.8997.56779forward
CNT30595987Oryza sativaOryza meridionalis100.1173.8597901forward
CNT30369760Oryza sativaOryza glumipatula86.6790.899.23780forward
CNT30105059Oryza sativaOryza longistaminata100.4497.197.46904forward
CNT30101055Oryza sativaOryza rufipogon100.3393.6799.67903forward
CNT30575926Oryza sativaOryza barthii86.5692.9699.1779forward
CNT30116356Oryza sativaOryza nivara73.5662.0498.19662forward
CNT30603889Oryza sativaOryza punctata100.5681.0993.7905forward
CNT30550796Oryza sativaOryza brachyantha47.3333.5485.68426forward

Expression of CNT30692489

Peptides detected in this lncRNA

>peptide 1 (29 aa)
GLETLRFHAIKRNSVTPPCHFFATYSIPS*

>peptide 2 (29 aa)
MMVLIIQFLLLILKVLCQDKKSLCKPSKP*

>peptide 3 (39 aa)
MNGRSNLQWRIMDHRIGLSSRAIYDYMHSIIDAIMQVCN*

>peptide 4 (34 aa)
MKTIIIKRIEDSIFFFLGSAGKIIQIVEQVQVAI*

Sequence

>CNT30692489
AGGGTTAGAAACCCTTAGATTTCATGCCATCAAGCGTAACAGTGTAACCCCACCATGTCATTTCTTTGCTACTTATAGCATCCCAAGTTGATGATCCATT
TCATGTTTTCTCTCCTTTTTCAGATGCATACTATGATGTCCAATGTGGGTGTCTGAACTGAAATCTGAACTCTGAACTCTGAAGGCTGTTGTTTCCATCA
GGGTGCATTGGTTCAGCAGAGATCGGTGATCTATGTTTTCATATTTGGTCACGTTCTACCGGTCTTTTTCGATGGAAATGAAGGTAATTGGAGGAGTTCT
ATCTGTTTGATGGAATTCAGAACCAAAATCCGAATTCCACAAAATGGCTAGAGGAAAATTTTTAGGGCTATTTGCAATTCCACAACCATAAGCATGGCCA
ACTGGTAGTTCTCCAAGTAAAAGAAGTTAGGAGCTGGTTATGATGGTACTAATTATTCAGTTTCTTCTATTGATCCTGAAAGTTCTATGCCAGGATAAGA
AAAGCTTGTGCAAACCCTCCAAGCCATGAAAACAATTATCATCAAGAGAATTGAAGATTCTATTTTTTTTTTCTTAGGATCTGCAGGGAAAATTATTCAG
ATAGTGGAACAGGTTCAAGTAGCCATTTGAAACTCAACACAACTTTATATCAAGAACAAATGAACAATGAATGGTAGATCCAATCTTCAATGGAGAATCA
TGGACCACCGAATTGGGCTATCTTCCCGAGCTATCTACGACTACATGCATAGTATAATAGATGCAATCATGCAAGTGTGCAACTAGTAGTTTTTTTTTTC
TGAAGGAGATGAGATTAGGTATAGCATGTAATGGTCCTGGTGTATAATGCCATGGCACACTCAACTTGCATTTAAACAATGCTAGTCCCTGCAGACCTTG