Detailed information on CNT30692389


BLAST search results

BLAST vs Swiss-Prot:
sp|Q8GX47|CAP3_ARATH, E-value = 8e-44

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678746Oryza sativaSetaria viridis19.7644.6491.33150forward
CNT30445863Oryza sativaSaccharum spontaneum53.6237.4888.21407forward
CNT30100729Oryza sativaOryza rufipogon86.1750.31100654forward
CNT30117787Oryza sativaOryza nivara47.0437.15100357forward

Expression of CNT30692389

Peptides detected in this lncRNA

>peptide 1 (83 aa)
MDPYHLSLWPSAWTDCSLSPQGQVPSQPSQAQLQDSAMQKSPHCHHLRGRPPMSHCFHQLQVALGRGPEQAGYLAHLQSQFLL*

>peptide 2 (68 aa)
MHKARQSALRRWHMPQMPSRTRHTPCQRTYPAALRAPHIYQHRAGSSLSQSDTARPAPSCCAWHHLWGG

Sequence

>CNT30692389
CGCTGCTGGCACTCCCAGTTGTCACTTGTGCATTGACATGCTGGCGCACGGCACCCTGATCATACATACCATTCAGTAGCAATGGATCCATACCACCTGT
CATTGTGGCCTTCTGCTTGGACAGATTGCTCGCTGTCTCCACAAGGGCAAGTTCCCAGTCAGCCTTCCCAGGCTCAGCTGCAGGATTCTGCCATGCAGAA
GTCACCTCATTGCCACCATTTGAGGGGAAGGCCTCCCATGAGCCATTGCTTCCACCAGCTGCAGGTGGCCCTTGGAAGAGGGCCAGAGCAAGCCGGTTAC
CTTGCTCATCTGCAGTCACAGTTTCTTCTCTAAGATCCACTAAATCACCCTGGGGTTGCGGTGGGGGCTCTGGCTTTACTTCCTCCTCCACCTTCTCAGG
TTCAGGCTCAGGCTCCCGAGGTGGGCTCTTGGGCCGCTTTGCTCGGTCCCTCATAAATTCCTCCAATGTCTCCAGCAACTTATCGGTAACACGCTGCACC
TCTGGGTACTCTGATGACCTAGCGACCCCAGTTTCCTTACACCAGCCATAGAATGCACAAAGCTCGTCAATCTGCTTTGCGGCGCTGGCATATGCCTCAA
ATGCCTTCACGCACTCGGCATACTCCATGTCAAAGAACCTATCCAGCAGCACTGCGAGCACCTCACATATATCAGCATAGAGCTGGAAGCTCTCTCTCAC
AATCTGATACAGCGCGACCAGCACCATCCTGCTGTGCTTGGCACCACCTGTGGGGCGGC