Detailed information on CNT30692252


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553128Oryza sativaOryza glaberrima91.0279.3199.5598forward
CNT30107330Oryza sativaOryza longistaminata35.0185.1995.65230forward
CNT30100741Oryza sativaOryza rufipogon62.2587.02100409forward
CNT30575620Oryza sativaOryza barthii91.0283.8799.5598forward
CNT30116257Oryza sativaOryza nivara56.4764.399.46371forward

Expression of CNT30692252

Peptides detected in this lncRNA

>peptide 1 (64 aa)
DKSVPPAPMTPRRRRPAAAIWRFRGGLERVDHRCALAAVDRDDGGSLFSASPGPLQLHSILDKH*

Sequence

>CNT30692252
GAGACAAATCGGTTCCTCCGGCTCCGATGACCCCGCGGCGGCGCCGGCCGGCGGCGGCGATATGGCGGTTTCGTGGGGGGCTTGAGCGTGTCGACCACCG
GTGTGCCCTCGCCGCCGTGGACCGAGACGACGGCGGCTCCCTCTTCTCTGCTTCCCCAGGTCCACTTCAGCTGCACAGTATACTGGATAAGCACTGAACG
AAGACTGTATTAACTTATTAGCAGTTTGAAACGTATTTGATGCCCGTGCCAAGCAACTAAACAAGAGGCCTTCGAATTGTCATTGACGAAGACCTGAGCT
ACGGGCCTAAGGTGTGTCCATGTTTTACTCCAGTTTGGATCATGTGACCGGCATCTTGGATCTTGCCAATTGCAGTCCCAGAAATTCAGGTAGGAGCAAA
TGAAATGAGGAGCATATGCAAATTGGGACTATCTTTAGGACACGTTTGCAGGCAGGATTATTTTTGCCGTTTATATGGGAAATCGAGCTGATTTGAATTA
GATTCCTGTATTTGGTTTCATGTACTTGAGTTGAATGCGCTTAAATGCGTCCGATTTCCATAGGCTTCAGTAGAGCGTGTTTAATGTTCTTTCTACCTCC
AATTTTAGCAACTCTTTGATTCTGTGCGCATGCAGCATATTTCTTCCAAGGAAGTAC