Detailed information on CNT30692223


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30371521Oryza sativaOryza glumipatula89.8250.7999.67900forward
CNT30100626Oryza sativaOryza rufipogon89.8254.38100900forward
CNT30575860Oryza sativaOryza barthii90.0256.1399.56902forward

Expression of CNT30692223

Peptides detected in this lncRNA

>peptide 1 (52 aa)
MAPRATFVLLAWRHRRRRAAAEVPRPESAASPRELEAPGRPAIQKNVVHDDL*

>peptide 2 (52 aa)
MMISRRRRKVIRISRSDRRSKAFFHKRKYGALMGFPKREGKDQGDDMIKARN*

>peptide 3 (50 aa)
MHGSTRHLCIAGVAPSPASRRRRGAPAGIRRLSSGTRSSRKTGDPEERCP*

>peptide 4 (47 aa)
PCDRSIDPRGGGRGGGCRRRPPRRCMTGRAAEAAPPCCRRRGTTTTT*

Sequence

>CNT30692223
ACCGTGTGATAGATCGATCGATCCTAGAGGCGGAGGACGCGGCGGAGGCTGTCGGCGGCGGCCGCCTCGGCGTTGCATGACGGGGCGGGCGGCGGAGGCG
GCACCACCTTGTTGCCGGCGGCGGGGGACGACGACGACGACGTGATCACGAACCTGGGCAGCGGCAGGCTGCTCGGCGGCGGCGCGAGCACGTGCAGCAG
GTCCTGGACGAAGTTGCGGGCCACCTCCTGCTCCAGGTCGTCCAGGGCCTCCGCCACCGCCGGCGCCGGCGGCAGCGGCGTTGCCCGCTCCAGCGGCTTC
TTCTTCTGTGTTCCTCCCTTCGTCGTCTCCGTCGACGGCGGCGGCCTCGACGGCTTCCTCCTCCTGTCCCTCTGGCGCGTCGACGGAGTACTAGCTCTGC
CGCTGCGCGGCGGCTGCTGCGGCGGAGGCGGGTACGGGAAAGTGGCGTACTTGGTGGCGGCGGGTGGGAGCGGCAGGAGAGGTGGCTGGTTGGACGGCAG
GAGAGGCAGAGACGGCGACGAGTACAGCGGAGGCCTCGCGTACGGGAGCGCGGGTAGTGATGCATGGCTCCACGCGCCACCTTTGTATTGCTGGCGTGGC
GCCATCGCCGGCGTCGCGCCGCCGCCGAGGTGCCCCGGCCGGAATCCGCCGCCTCTCCTCGGGAACTCGAAGCTCCCGGAAGACCGGCGATCCAGAAGAA
CGTTGTCCATGATGATCTCTAGGAGGAGACGAAAAGTAATTCGAATTTCTCGCTCAGATCGTCGATCTAAGGCGTTTTTCCACAAAAGGAAATATGGAGC
CTTGATGGGATTTCCAAAGAGAGAAGGAAAAGATCAAGGGGACGATATGATCAAAGCTCGAAATTAAATTATATCGAACTTGTGTCTGTGTATCAGTTTT
TGCATGAAATTTGCAAGAAGTAATTAATTAACTAGATCCTTGGGATTAAAAACAACAAGGATGCTAGCTAACTATATATATGATCGATCGGTTTCGATCA
AG