Detailed information on CNT30692204


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552942Oryza sativaOryza glaberrima51.5359.7699.34303forward
CNT30575849Oryza sativaOryza barthii46.7798.2199.27275forward

Expression of CNT30692204

Peptides detected in this lncRNA

>peptide 1 (66 aa)
MANQIHPKGDNQECCRNVGNAPDWQEELWDHDRHRDDNIVENKGNSRGNNSPHQEEAIQYVDLLQG*

Sequence

>CNT30692204
AGGTCAACATAAACTGTGACGTACTCTACAATTTAAAAATGCTTTCTGGAGAAATTTAAACACAGAAAAGAATCACATATCAGATTGATGAAACGGCAGC
AGATTTGACTTGATTTGTCAGAAGCAGCAATGATCAGGTAGAGTGCCAACGCAATTCAGCCCCAGAAGAAAGAAGGCTAATCCTTGGAGATAGAGATTTA
TGTAGAAGCTGTTCTTTCCATGGAAGACAAGGTTGTAGGATGCACAAAAGATGAGGAACACCGATAATCCGATCTCAGTTGCAGCAGACCAGCTACAGCA
GCTCTCAACCGATGCATGGACATGACGCTCTCGAATAAAATCCACAGTGGCACTGTGTGCAGATTTCTGGAGTGAAAAGACAGTTATGGCAAATCAAATT
CATCCAAAAGGTGACAATCAGGAGTGCTGTAGGAATGTAGGCAACGCCCCAGATTGGCAGGAAGAGCTCTGGGATCATGACCGACACAGGGATGATAACA
TTGTAGAGAATAAAGGCAACAGCAGGGGCAACAACTCTCCTCACCAGGAAGAAGCTATACAGTATGTAGATCTTCTTCAAGGATGACA