Detailed information on CNT30692194


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9FZ32|FB60_ARATH, E-value = 8e-41

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30369954Oryza sativaOryza glumipatula29.7410099.52417forward
CNT30101049Oryza sativaOryza rufipogon10097.6399.931402forward

Expression of CNT30692194

Peptides detected in this lncRNA

>peptide 1 (75 aa)
FVILIYVKKAIAMDFIKFITPRKKKMIHYICSQIHIITCTEGKPHIYCSSGQTGSSDLPITCIIMPCPYLPIDLT*

>peptide 2 (48 aa)
MVAHHVVETFYIGHLLAIHRAPKSEERCSHKQSASLWNKGDKCAEWYR*

>peptide 3 (93 aa)
MLLKRFISVTCLQFIEHQRVKNVAHTSKVHLCGTKETSVQNGIDKQNSQMYKVKLCMVFKVQLHQLLKRVFQQNSHHTNGYIYNQLYTATDRI*

>peptide 4 (41 aa)
RHTYICKESNCYGFHQVHHTEKKKDDTLHMFTNSHYYMYRG*

>peptide 5 (29 aa)
MITSSGLFVAAPTLGPQSTPSWLPLDHRL*

>peptide 6 (45 aa)
MAKGVKRQVLDYLNLKKCIELSCLFLWLHIISVSVTSNLCSFHSR*

Sequence

>CNT30692194
TTCGTCATACTTATATATGTAAAGAAAGCAATTGCTATGGATTTCATCAAGTTCATCACACCGAGAAAAAAAAAGATGATACATTACATATGTTCACAAA
TTCACATTATTACATGTACAGAGGGTAAACCACATATATATTGTTCAAGCGGCCAAACAGGTAGTAGTGATCTTCCAATAACCTGCATCATTATGCCATG
CCCTTATCTTCCCATTGACCTTACATGATTACATCTAGTGGCCTGTTTGTTGCCGCTCCCACCTTAGGTCCTCAGAGTACTCCATCATGGCTGCCCTTGG
ATCACCGTCTGTGACAGATAAGTAGTACGCAGCGGTTCTGTCATCGGTATGCAAGCTTCGCTTGACTGACTCCAAAATCCTTCTGCTTCGTCGTTCTGCA
GCAGCAGTGTTCGTCGAGGATTCTGCTTTTCCACTAGGGCGTCCCTGGGGATAAAAGACTGCAACCTCTCTTCTAGCGTTATAATCCATCTCAATGTAGC
ATGTGCTACCCTGAAGAATTTCAGGATTGCTGATCGGTATCAGAAGCCTCTCCCTCAAGTAGATCCCATGGTCGCTCATCATGTTGTTGAAACGTTTTAT
ATCGGTCACCTGCTTGCAATTCATAGAGCACCAAAGAGTGAAGAACGTTGCTCACACAAGCAAAGTGCATCTTTGTGGAACAAAGGAGACAAGTGTGCAG
AATGGTATAGATAAACAGAATTCACAAATGTACAAAGTAAAGTTATGTATGGTTTTCAAAGTTCAGCTGCATCAACTATTAAAGAGAGTATTCCAGCAAA
ATTCACACCACACAAATGGCTATATCTATAATCAACTCTACACGGCAACAGATAGAATCTAGCAGCTGAAGGTGCATAGGCATTGTGCAGCAATCCCTAA
ATAATCTTCTTTGAACAAGAGTGAATCTCATGAATTTGCAACTATCATTAACAGTTTAGCACATAGCAGGAATCGTCCAACTTTTGCACAGTCAAAAATT
AGTGGTGAGCTCCACAATACTGAGAATGGCCAAAGGTGTCAAACGCCAGGTCCTAGATTATTTAAACCTTAAAAAATGTATTGAATTGTCGTGCTTGTTC
TTATGGCTACACATTATCAGCGTCTCAGTGACTAGTAACCTTTGTTCATTTCATTCCAGATGACCTCCCTTCTCAGCAACCACTCAGAATATTCTAAGCT
CCAGTGTCTCCATCTTTGGATAAAAAGACATGTTACTGTTGTTTAAAACTATCGGTTGTCAAAATTAAGTGCTGCTTGGATCTTCCACGGGGTAATTAGG
GGCAAATCTATATGAGAATCATACCCTTTTGTGTATAACAAGAAGGATAACTAGGCGCAAATATGCATAGAGCTAGCGATAGAGCCATAATCGAGCATCA
GA