Detailed information on CNT30692183


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30101072Oryza sativaOryza rufipogon53.5826.34100157forward

Expression of CNT30692183

Peptides detected in this lncRNA

>peptide 1 (76 aa)
FPSTEPPLVLMTCSGATCSSTASIRHSSQFHAHPSPSAPAPRRMQPAQQDKRRRRRRRRRKAITRRDGRMRGAGGQ*

>peptide 2 (50 aa)
LPEHRASPRADDLLRRHLLLHRLHPPLLSIPRAPLSVSPCAAAHATSTTR*

>peptide 3 (30 aa)
MGGCGERAANRRGETRRGDETRRRKGTVGVA

Sequence

>CNT30692183
CTTCCCGAGCACCGAGCCTCCCCTCGTGCTGATGACCTGCTCCGGCGCCACCTGCTCCTCCACCGCCTCCATCCGCCACTCCTCTCAATTCCACGCGCAC
CCCTCTCCGTCAGCCCCTGCGCCGCGGCGCATGCAACCAGCACAACAAGATAAGCGTAGGCGGCGGCGGAGGAGGAGGCGGAAGGCGATAACGCGGCGAG
ATGGGAGGATGCGGGGAGCGGGCGGCCAATAGGCGAGGCGAGACGAGGCGAGGAGATGAAACGCGGAGGCGAAAGGGGACGGTTGGGGTAGCG