Detailed information on CNT30691963


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30101029Oryza sativaOryza rufipogon68.4669.499.051261forward
CNT30116115Oryza sativaOryza nivara53.42100.199.39984forward

Expression of CNT30691963

Peptides detected in this lncRNA

>peptide 1 (78 aa)
MYMYSFRTPHQNRTKAAAHEWNLSLGRRELVCPNVVTAVLLIVYRDNCPMFKGLRTCFARTRLIHVAWLHLRLDNVTR*

>peptide 2 (53 aa)
MTRGLDGRTPVRQRCRRFFCQDYPNHPTNPVMCYSEFSLSSIILSLTIHLGII*

>peptide 3 (43 aa)
YREIYLVESNLTRISVSYNMISLCPIPQPFNLQCQEFDFPLNY*

>peptide 4 (36 aa)
MEGRPCGSVVAGFFVRIIPTTQLIPSCVTLSFLLAA*

>peptide 5 (35 aa)
MSLTFFLADGLVQKLSTMLEHKMELSLIILHFRLC*

>peptide 6 (35 aa)
MLLCRKCFSKFNENASFSANKRARIKPLISPFFYL*

Sequence

>CNT30691963
TCTATAGAGAGATTTATTTGGTGGAAAGTAATTTGACTAGAATTTCTGTTTCGTATAATATGATCTCTCTCTGTCCAATACCTCAACCATTTAACTTACA
ATGTCAAGAATTTGATTTCCCACTTAATTACTAAACCGCATGCTCTTTATTCTGTGCAGCTCTATATTAAGTGTTTAATTTCTTAAATTTGGGGATACTA
TGTTCATGATGTTTCAATATTAAAAAAAGGCATCTTGGCATCATTCAATGTATATATGCATTTATCTGGGCCCTATGTATTCCCAAAATTATGAAGTAAA
GTGCTTTGAGTAAAGGGTGGGCATATCACAACTCATAGAAAGCTATAATCTAGTGGGGGCAAACTGTACTCCAATGTTCCACAAAAGGATTACCAGAAGA
TGTTGCATTAAAAGGTATGGTCGGCTCATGCTGGTGCCTAGTTCCTCTGCCTAACCTGATGTTTTTAGTGTTGGAATCAAGATCTGTAGTAAAACCTTAA
ATCCAGTGTAGGGCACAGCCACACAACCGCTGGTCTGCTATCGCCACTCTTTATTTTTACCACTTGTGTCCAATATTTGCTGCTATCGCCACTCTTTATT
TTTACCACTTGTGTCCAATATTTGCGAAGTTGTTCCACCTTTGCATCTGGATCTTTGCTGTTCATGTGACGGTTGCATGTTATGAGCCTCACATTTTTTT
TGGCTGATGGTCTCGTACAAAAGCTCTCTACTATGCTGGAGCACAAAATGGAATTATCCTTAATCATTCTACACTTTCGTCTTTGTTAGATGCTCTTGTG
CAGAAAGTGCTTTTCAAAATTCAATGAAAATGCCTCTTTTTCTGCAAATAAGAGAGCGAGAATAAAACCTTTGATATCACCCTTTTTCTATCTGTAATCA
CTATGCCCGACCATTAGTAAAAAAGAGGTTGTTCTGCTCAAAAGTTTTGATCGATTCTCTTTCACCTGCAGCTGAGGTTCTTTTTTCTAGTGGGCGTGGC
CCATGGAATGCCTCAACTTTGATCTTTATAACAGCTTAGATGCTTAACAGCGACAAATCCTTTGCGTCAGGCAAAATAAAACCAGCATACCAATTTGCGT
ACTAATACAGTAAACGTCAAGCAATGTACATGTACAGCTTCAGGACGCCACATCAAAACCGAACCAAGGCAGCAGCACACGAGTGGAACCTGAGCCTAGG
GCGGAGAGAATTAGTATGTCCGAATGTCGTTACTGCCGTCCTGTTGATTGTTTACAGAGACAATTGTCCCATGTTTAAGGGTCTCAGAACTTGTTTTGCC
AGGACCAGACTGATCCATGTTGCCTGGCTTCATTTAAGATTGGACAATGTGACACGATGATAGCATAACCGATGCTTCATTAGCAGCATCTTATGGAGAT
TTGACAACCTGGAATTTCGCAGGGTGACATGACCAGAGGCCTGGATGGAAGGACGCCCGTGCGGCAGCGTTGTCGCAGGTTTTTTTGTCAGGATTATCCC
AACCACCCAACTAATCCCGTCATGTGTTACTCTGAGTTTTCTCTTAGCAGCATAATTTTGTCTTTGACGATCCATCTGGGCATTATTTAGGATGTTTAGT
CCTAAAGAAAAGCTTAGTTTGACGGCCAGTATGTTGAGGTGTTTGTCATTTTCTTTGTAACGAAATGACTACTTTCTCCGTCTCACATTGACACATTATA
ATACTATTAATCTTTGTCTCACAATAAGTTAAATTTTATACTAAATATAGCATATCATAGTAATTATGAACATGAATTCATTACTACGATGATGTATCAC
ATGCAGTATTAGATTAATTCATTGAGAAACAGGAGTACCTAC