Detailed information on CNT30691962


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000657, E-value = 9e-110

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30369870Oryza sativaOryza glumipatula17.453.0496.93358forward
CNT30105370Oryza sativaOryza longistaminata10.1169.5798.56208forward
CNT30575842Oryza sativaOryza barthii28.6761.3399.66590forward

Expression of CNT30691962

Peptides detected in this lncRNA

>peptide 1 (41 aa)
MFDIYGVEFTHKPLVNWFNENVVKKAVHLQVGFLGGLTVEE*

>peptide 2 (66 aa)
MLLRGEAGDQPSAKVFRRFVHDAIERPDEFILHPAAPLPPSVEIVRVMDVISNFVPHFLLKFAASE*

>peptide 3 (32 aa)
PLRFPSSCSAPPPTSSGEERRRPAAGSRDRQQ*

>peptide 4 (95 aa)
ARYAFLPLAPRLRRRAPVRSGGDRQPAAETDSSEGLPSTRTNWTSKCSCAAKPETSRRPRSSAASSMTPSRDRTSSYCILPLRCHRPWRLSASWM*

Sequence

>CNT30691962
GCCCGCTACGCTTTCCTTCCTCTTGCTCCGCGCCTCCGCCGACGAGCTCCGGTGAGGAGCGGCGGCGACCGGCAGCCGGCAGCCGAGACAGACAGCAGTG
AAGGATTGCCATCAACACGAACCAACTGGACATCGAAATGCTCTTGCGCGGCGAAGCCGGAGACCAGCCGTCGGCCAAGGTCTTCCGCCGCTTCGTCCAT
GACGCCATCGAGAGACCGGACGAGTTCATATTGCATCCTGCCGCTCCGCTGCCACCGTCCGTGGAGATTGTCCGCGTCATGGATGTGATATCCAATTTTG
TACCCCACTTCCTCTTGAAATTTGCAGCATCTGAGTAGGTATGGAGGGAGTGATGCGTTTTTTGCGATTGATGATTTGGTCAGGTTTACTCACTGATTCA
GCAGAGCTGTAGAGGAACACGCAATCAGATATGCAAGGCTGTGTTTAGTTCAGCGCAAAGTTTAGATTTTGGTTAAAATTAAAAATGATGTGACTGAAAA
GTTGTGTGTGTATGACATGTTGATGTGATGGAAAAGGACTGAAGTTTGGATCCAAACTTTGGATCTAAACACAGCCTAAAATGCATGGTGCAATGAATCT
GCCATGGTGGTAAGCTGTGAAACCTGGATGCTCTGGTCTCTGGAACCTAAATTATATACTCCCTCCGTCCTATATTATAAGGGATTTTGAGTTTTTGTTT
TCAACGTTTGACCACTCGTCTTGATTAAAAAATTTTAAAATTATTATTTATTTAATTGTGACCTACTTTATTATCTACAGTACTTTAAGCATAATTTTTC
GTTTTTTACATTTGAAAAAAAAATTTGAATAAGACGAGCGGTCAAACGTTGTAAGCAAAAACTCAAAATCCCTTATATTGTGGGACGGAGGGAGTAGTAC
TTATGTACTATGTGAGTTTTTGGAGAATTTTGAGCATCTTGAAATAACCTCGATAGTACCCAAATCGTTTGGTTTGAAAAGAAGTGATCGAACTGAGTGA
AACATGACCAGGTCTGTACCGTTAAATTTCAATTTCCTGTAACTCTCTGTCTCTAAAATCCTGTATATACCTGATGTTTGAATCTCCTGAAAATGTAGAT
GAAGATTCAGTGTTTCACGTAAAACGAGGTGGTGATAACGTGTGATTAATTAAGTTTTAATTATTACAAACTTAAAAAATAGATTAATCTAATATATTAG
AGCAACTTTCATATGAAAAGTTTTCGCACGAAACGCACCGTTTAACAGTTTAAAAAACGTGCCACGAGTATACAAAATTTCATCCAAGCCTTGTTGGAGA
AAAGAACAGGGCACGTTGAGACTGAAGCAAGTAAATCAAATTGCATGCTGACCTTCGAAAGATCTTCCTAAAGGTTTCCCTTTTTTGTGTGTGTGTGTGT
GTGTGTTACCGAATCCCCTACTTCTTTTTAATTGGAGTGTCACTAACAACCTAATGTTACTCCTTTACAGATAATGTCGAGCATGTTAATCAGATCAACC
TTGAGATTGCTAGCTGGGTAGAAAGTGACTATCAAATACAGTTTTTCCCGTCGAACTATTCATCTTGGTTTTGCATTCCTTGTTCCAGTTGACTATCTGC
AGCTTACTATCAGCAAGTGATATCATTATTTGGTACCATTACTTGTTGGTGAGATATATATGTTCGACATATATGGTGTTGAGTTCACACACAAACCTTT
GGTAAATTGGTTCAATGAAAATGTTGTGAAGAAAGCTGTCCACCTGCAGGTTGGATTCCTAGGGGGGTTGACTGTTGAGGAATAAAGCAATCCAATGGAT
ATTTCAAAGTAAAATGGTCTAATGATAGTTACAGGTTCAGGAACCTTATCATCAGCAATTGAGATGGGCCTCAGATGAGGAAGTATGTCCCCTTCGTTCC
AGTCACCAAACATTAGCTAAAAAACGTGTCCCCTGCACTAATCTAGCTGTTATTTTGATCATATGTCATAAACTGTTCAAAAAATAAGTCCACTGACTGT
TGTCCCCAGTCTATGCTGTTCCATGAAATCTGTAATTTAATCAAACGTTGAAGAACCG