Detailed information on CNT30691897


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30677870Oryza sativaSetaria viridis10.7231.2391.1479forward
CNT30282360Oryza sativaChenopodium quinoa8.6831.2298.4464forward
CNT30553095Oryza sativaOryza glaberrima43.8381.1699.69323reverse complement
CNT30205883Oryza sativaHelianthus annuus9.773298.6172reverse complement
CNT30100908Oryza sativaOryza rufipogon40.8443.81100301forward
CNT30575942Oryza sativaOryza barthii70.5676.2599.42520forward

Expression of CNT30691897

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MFQNPPLKPKPAVQYNITRVSDQSTAKGSYKSNAISSPKDPQI*

>peptide 2 (60 aa)
MAPSFQTRYVVPNMTTVMSVKEAAMTITSVPNGSASNVHPSLGRPPLSSPPSGSDASSRR*

>peptide 3 (29 aa)
ESAAKTFFYSVAAGIRAQVSTATTWNSHH*

>peptide 4 (36 aa)
MNQLQKHFFIVWLLGFEPRSPRPQRGILTTKLQPLW*

Sequence

>CNT30691897
ATGAATCAGCTGCAAAAACATTTTTTTATAGTGTGGCTGCTGGGATTCGAGCCCAGGTCTCCACGGCCACAACGTGGAATTCTCACCACTAAACTACAGC
CACTTTGGTGAAAAGAGAGGATGTAAAACCCTATTTGTAAATATGATTTTTTTACTAATCATATTAGTAGAATAATAACTATATTAAGTAAACTATCGAT
TCGTACAACGATGTTCCAAAATCCACCCTTAAAACCAAAGCCGGCAGTTCAGTACAATATCACACGAGTATCTGATCAAAGCACCGCAAAAGGCAGCTAC
AAATCCAACGCGATTTCATCACCCAAAGACCCACAAATCTAGCGAGCTCATTGTGTGAGTGATAGTACGTAGCCTAGAACTCGTTGAAGTGAATGGCGCC
GAGCTTCCAGACGAGGTACGTGGTGCCGAACATGACGACGGTGATGAGCGTGAAGGAGGCGGCGATGACGATCACGTCGGTGCCGAACGGCAGCGCCTCG
AACGTCCACCCTTCCTTGGGCAGGCCGCCGCTGTCGTCGCCGCCTTCTGGAAGTGATGCCTCGAGCAGAAGGTGAGCTGCGTGTATGGCGAGGAAGATCT
GGTGACGCCTCCTCCTAGCTGCACATCCAGTTGCATCGGCAAGCCAAGATTAATTAGCATGCTTAAACAGCTAACCAATCACAACTCTAAAGATGGTCGA
AACTCGAAACAGTTTCACTGAATTATGCACGTAACCC