Detailed information on CNT30691875


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT003927, E-value = 8e-145

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553102Oryza sativaOryza glaberrima57.5899.54100437forward
CNT3067165Oryza sativaLeersia perrieri49.01101.9284.95372forward
CNT30595975Oryza sativaOryza meridionalis50.9998.9898.19387forward
CNT30100753Oryza sativaOryza rufipogon55.4792.32100421forward
CNT30575871Oryza sativaOryza barthii52.4484.5100398forward

Expression of CNT30691875

Peptides detected in this lncRNA

>peptide 1 (47 aa)
MYSWLLIMLMLFWVPTTPEFTRKQMLGKLRRTGSTDIHIDKGKAMGL*

>peptide 2 (36 aa)
MKTGIHYDTLSDVRLQVSEALTRCICALHDLISFLV*

>peptide 3 (48 aa)
SQSQILTVPKKCNNCILTEGMGWHIYTVPYNNHLQASLARSKHKNEWA*

>peptide 4 (34 aa)
MDSLMGSSLLAEVEEPHVLMVVDHADALLGSNNT*

Sequence

>CNT30691875
TCACAATCACAAATTCTGACAGTACCTAAAAAATGCAACAATTGTATATTGACAGAAGGAATGGGCTGGCATATTTACACTGTTCCATACAATAACCATT
TGCAGGCTAGCTTAGCCAGGAGCAAGCACAAGAATGAATGGGCATAGCTGCGATTTCTCCCTAGAGAAACTAAATTGCAGGTTAGCCAGGAGCTAACACA
TGCATATGCCATGAAAACTGGAATACACTACGATACTTTGTCGGACGTGCGCTTGCAGGTTAGCGAGGCGCTAACGCGGTGCATATGTGCACTTCACGAC
CTTATTTCTTTTCTCGTTTAAATTTGGGGGAGGTGAGGTCAATTAGGTGTTGACCTGGATTTCCCCCAGAGAGTATGGACAGTCTGATGGGTTCTTCACT
TCTCGCAGAAGTCGAGGAACCCCATGTACTCATGGTTGTTGATCATGCTGATGCTCTTCTGGGTTCCAACAACACCTGAATTTACGAGGAAACAAATGTT
AGGAAAGCTGAGAAGAACAGGCAGTACAGACATACATATAGATAAAGGCAAAGCGATGGGCCTATAAAGGCTAATCAAGGAACGGCTTTTGCAGGCCAAA
CTGGTTTGAACCTGTCAATACTAAAGTGTATTCTGTTTAGATGTTTCTAAGGAAAACGTAGGATCCATGGTAAATGATTTTGTTGGCTGAATTTCAATTA
GACTGCATAGCACTTAGTGGTTTGTTATCTAAAAAGGACATTCAGTCAATGTGTTCTGG