Detailed information on CNT30691852


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30712239Oryza sativaGlycine max17.1826.4189.8989forward
CNT30187696Oryza sativaSecale cereale31.8556.3190.3165forward
CNT30553214Oryza sativaOryza glaberrima53.2857.599.28276forward
CNT30350693Oryza sativaEragrostis tef45.3726.7789.79235forward
CNT30361195Oryza sativaSorghum bicolor44.0243.2690.79228forward
CNT30619573Oryza sativaCajanus cajan18.9226.1389.898forward
CNT30575837Oryza sativaOryza barthii71.2480.3998.64369forward
CNT30499344Oryza sativaDigitaria exilis28.5720.4787.16148reverse complement
CNT30117949Oryza sativaOryza nivara73.1780.4799.74379forward

Expression of CNT30691852

Peptides detected in this lncRNA

>peptide 1 (49 aa)
MVAAVRAPQPKPKRRPETTTRMSLARSWTDEAASEAGGGGGHGDAVDLGE

Sequence

>CNT30691852
CTTCAGTTTCACTTTAAATTATGTAAGAAAACATCAAGACCGTATTCATAATTTGTTTCTTTTCGAAATCACACACACATACTGAGTCAGACAGACGCAA
CACATATATAGGTGCTAATAGTAGTATATATACCCCGCAAATCCACGCGATCATTTATCACAAATTCTTAAATTGGCCATCGGCGAGATAGCCCAATTCC
CCACCCCTAGTTCTTACCGCCGACGTACTGTTCGGCGTCGTGGATGATGACGTATCCGGCCTTCTTGGGGCTCTCGGAGTCGGACAGCTCGTCGTCGTCG
TCTTCGCCGTAGACCTCGTCGTAGGAAGGAGCGCAGGTGGAGGCGAGGAGGGACCAGACGAGGTACATGGTCGCGGCGGTGAGGGCGCCGCAGCCGAAGC
CGAAGAGGAGGCCGGAGACGACGACGAGGATGTCCTTGGCGCGCTCCTGGACGGACGAGGCGGCGTCGGAGGCGGGCGGCGGCGGCGGCCATGGCGACGC
GGTGGATTTGGGGGAAAA