Detailed information on CNT30691733


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553511Oryza sativaOryza glaberrima23.4366.5996.04303forward
CNT30101033Oryza sativaOryza rufipogon17.25100100223forward
CNT30575945Oryza sativaOryza barthii28.3197.0899.45366forward

Expression of CNT30691733

Peptides detected in this lncRNA

>peptide 1 (88 aa)
MPARGEPLPPPFRLYISPSRPATDLPGCASLGNTRGRCRRGRSSTGASAPLLSLLSVCSAGREEEAEEGRRKKKEKRRRRDKELTESI*

>peptide 2 (78 aa)
MSRSPSPGAATFRMSRPNVDYLYTKLTAAIAKEDAALRAAIPVRQHVAVCVRCLAMGEPLSNRTRCFPAGHGAHGGLR*

>peptide 3 (76 aa)
MAAMGGGEEGDEWILHVSIALSWRRDLPHVPPQRRLPLHQAHRRHRQGGRRPPSCHPRPPARRRLCPMPRHGGATQ*

>peptide 4 (67 aa)
QSLELPFSLSIHGRSSTPSVDLPIRSSTSPILAPPASPPSGESVFPLSPLPPPLSQATTAIIHAGSR*

>peptide 5 (53 aa)
RASSSLSLSPSMADRRRRRSISPSVAPPPLSSRHRLRLHPASPFFPFPLSLHL*

>peptide 6 (34 aa)
MSVSESLVSGPDNEGERRLGGSLLRGRHGRHGWR*

Sequence

>CNT30691733
CAGAGCCTCGAGCTCCCTTTCTCTCTCTCCATCCATGGCCGATCGTCGACGCCGTCGGTCGATCTCCCCATCCGTAGCTCCACCTCCCCTATCCTCGCGC
CACCGGCTTCGCCTCCATCCGGCGAGTCCGTTTTTCCCCTTTCCCCTCTCCCTCCACCTCTAAGTCAAGCCACCACCGCCATCATCCATGCCGGCTCGAG
GTGAGCCCTTGCCGCCGCCGTTCCGGCTATATATCTCTCCCTCTCGGCCAGCCACCGACCTCCCCGGGTGCGCGTCGCTCGGGAACACGCGTGGCCGCTG
TCGTCGAGGCCGTTCATCCACCGGAGCATCGGCGCCCCTCCTCTCCCTTCTCTCTGTTTGCTCGGCTGGAAGAGAAGAAGAAGCAGAAGAAGGAAGGAGG
AAGAAGAAAGAGAAAAGAAGAAGAAGAGACAAAGAACTGACAGAGTCAATTTAATGTTCTTACCGAAGCCGGGAGTTCAATCATATAAGTTAGTGTCATT
TCAATCTAATTCTCAAGTCTAGATTAGATAGATGGTTTAAGTCTATAGCAAAACATTAGAGTTGGCTCATTCTATAGCTTCTACTGTAATAGTTAGCCAC
AAATTTGTAAATACCCGTATATTTTGTAATAACATCTCCTCTGGAGCCTTGTTCAAATGTATGCAATGAAGATCTAGATTGTTGAACCTGTATCAATCTA
CTGATCCAGGGCTTGATACAGTCTAAACATGTCGGTTTCCGAATCATTAGTTTCGGGACCCGACAACGAGGGGGAGCGCCGCCTGGGGGGGAGCCTGCTG
CGGGGTCGCCATGGCCGCCATGGGTGGAGGTGAGGAGGGAGACGAGTGGATTCTCCATGTCTCGATCGCCCTCTCCTGGCGCCGCGACCTTCCGCATGTC
CCGCCCCAACGTCGACTACCTCTACACCAAGCTCACCGCCGCCATCGCCAAGGAGGACGCCGCCCTCCGAGCTGCCATCCCCGTCCGCCAGCACGTCGCC
GTCTGTGTCCGATGCCTCGCCATGGGGGAGCCACTCAGTAACAGGACGCGGTGCTTCCCGGCAGGCCATGGAGCTCATGGAGGGTTAAGATGAAATTTAC
TGTGGGAGTTCGCTTGGATATATATTTTTTTAAAAAAATCATGAGCTGCAATTAGGAGTCCGATCGTCTCAAGTTAATATGCGAGTTTTTTTAAACAAAT
TTCTTATATGATTCCTTATGTATTACCAAAAGTGAACAAACCGACTCAAATACGGATATGTATTTCCAAAAGCAAACGAACTTAAAAACCGAC