Detailed information on CNT30691502


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671312Oryza sativaSetaria viridis24.4128.3595.793forward
CNT30519964Oryza sativaSetaria italica27.0314.3394.17103forward
CNT30552636Oryza sativaOryza glaberrima83.257.32100317forward
CNT30442397Oryza sativaAegilops tauschii23.368.9897.7589forward
CNT30667282Oryza sativaTriticum dicoccoides25.7222.0290.8298forward
CNT30686589Oryza sativaTriticum urartu23.369.0897.7589forward
CNT30364531Oryza sativaSorghum bicolor24.6729.3896.8194forward
CNT30595654Oryza sativaOryza meridionalis59.3238.6395.58226forward
CNT30369561Oryza sativaOryza glumipatula57.4835.7899.54219forward
CNT30100228Oryza sativaOryza rufipogon83.256.71100317forward

Expression of CNT30691502

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MGRSRRTPAAAPPSAPPPSLSPLSFSLLAAVCGSVEGCW

Sequence

>CNT30691502
GACACACTGACACACAGGGAGAAGTAATAATAAGTTACACATGGAATTACGGATGGAATTAAGCTGTAGAGCACAAGAGGATACAATAATCTAAGGGTTG
ATTTGGGGGGATTTTTTTTTTTCATTCGGTGAGGCGGGCGACGACGGGGTACTTGGCCTGGAACTTGGTCTCCCAGTCGGCGAGGACGCCGAGCTCCTTG
TCGGAGAGGCCGGAGAGGTGACGTCGTAGACCTTGCCGCGGACGGAGACGTAGATCGGCTTCGATGGGTCGCTCCCGTCGTACGCCCGCAGCTGCGCCGC
CGTCAGCTCCGCCGCCATCTCTCTCTCCTCTCTCTTTCTCTCTCCTCGCGGCTGTGTGTGGATCAGTGGAAGGTTGTTGGG