Detailed information on CNT30691491


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552575Oryza sativaOryza glaberrima57.44100.299.29980forward
CNT30369514Oryza sativaOryza glumipatula58.798599.11003forward
CNT30107388Oryza sativaOryza longistaminata59.299.3197.621010forward
CNT30100370Oryza sativaOryza rufipogon59.0395.1898.911007forward
CNT30575180Oryza sativaOryza barthii56.15100.2199.37958forward

Expression of CNT30691491

Peptides detected in this lncRNA

>peptide 1 (92 aa)
PTYRGINRSMDRWIAASSDISSPLLRREQHVSRLLLRFHGHMPRHGHPRARAPARRPHAASAAQIRRTLLPLLSRHRRHRRARRRGAAAPIS*

>peptide 2 (85 aa)
MDRGQLRYLFASTPPGATCVAAFASLPRPHAAPRAPARARARAPSSRRVRRPDPAHAPPPFEPPSPAPPRATARRSRTDLVNSPP*

>peptide 3 (73 aa)
RLHIAALIDRWIDGSRPAQISLRLYSAGSNMCRGFCFASTATCRATGTRARARPRAVLTPRPPPRSGARSSPF*

>peptide 4 (54 aa)
MNSSTYEHLARLRRLYIVYWLPLLNVSLITHDMLAWKGNFELIMRPVTILSSEL*

>peptide 5 (45 aa)
MPFSASSRRPLPSTVPVRRARGFSDSCKGMVTSLWQQLHILQENL*

>peptide 6 (35 aa)
MFVTLRLQGCNSLTIDCRTDHIKTAAKMVQNRVLC*

>peptide 7 (29 aa)
MFTFGRKKMCMTVLKQMKNSSFYEVNFCC*

Sequence

>CNT30691491
CGCCTACATATCGCGGCATTAATAGATCGATGGATCGATGGATCGCGGCCAGCTCAGATATCTCTTCGCCTCTACTCCGCCGGGAGCAACATGTGTCGCG
GCTTTTGCTTCGCTTCCACGGCCACATGCCGCGCCACGGGCACCCGCGCGCGCGCGCGCCCGCGCGCCGTCCTCACGCCGCGTCCGCCGCCCAGATCCGG
CGCACGCTCCTCCCCCTTTTGAGCCGCCATCGCCGGCACCGCCGCGCGCGACGGCGCGGCGCAGCCGCACCGATCTCGTGAATTCCCCTCCCTGACCACT
CTCCCGGCCCCGGCCCCAGCCACCACCTAAATCGCAATGCCTTTCTCCGCTAGCTCCCGCCGTCCCCTCCCCTCGACGGTGCCGGTGCGGCGCGCGCGTG
GTTTCTCAGATTCATGCAAGGGGATGGTGACAAGCTTGTGGCAGCAACTGCACATCTTGCAAGAAAATCTTTAGGGTTTTTCAGACCATACCGATGATTT
TCTTGCAAGTTGTGCAGTTGTTGTCTCAAGCTTGCTGCCTCCCTTTGCCAAAACTATCAAGTGAGAAAGCAGGGTAGAGTTATTCAATTACAGGCACACA
AGACAAAATTAAAGTAATAAACATGTCTGACCAACAAACACAATGATTAATAACAAAACTCTTGTGGCATGAGATAATATTGAAGCATGATGCTTACAAC
AGTTATAATATGAAAACTAGATGGAGGCAGTGCCACCAGGCAATTGCAAATGAACTCATCAACATATGAACATCTAGCAAGATTACGTCGTCTCTACATT
GTGTATTGGCTTCCACTGCTGAATGTTTCTCTTATTACCCATGACATGCTTGCTTGGAAGGGCAATTTTGAGTTGATCATGAGGCCAGTCACAATTCTTA
GTAGTGAATTATGAATTTCTAAATGCATTATGTTAGTTTCATGGCTTGATCCTTGGTTTCTTTGTTTTGTAGGTTTGCATGAATTTCTCTAGGAATGCCC
AGTGAGTGATCCTGTAAATTTTGGAGTTGATTGTTCATCAGAATAGCACTATAATTTTCCTGTCACCTGTGCTTTGGTAGCGGAACGTTCATTGTCCCAT
GCTACTCAGCTTTGTACTTTTGTAAATCAAATGAGACTGAATAATATATGTTTACTTTTGGAAGGAAAAAGATGTGTATGACTGTTCTCAAGCAAATGAA
AAATTCCAGCTTTTATGAAGTTAATTTCTGCTGTTAACATGCTACCTAGTGCATTCCTAGAATCCTAGTTAGTGTCTTAAACCTTGGTTGACCTATTCAG
CAGAATGCAAGGTTTGTAGGGATTACTATTTGAGAAAGGAAAACCAGTGCCTAGGTGCTTTCTTGAGTATGTAGTTTACTACTGAACCACCTATGTCCCA
AAATATAACCTGGACATTTCCTGTCTAGATTCATAGTCCTATAAAATATTTCTTTCTGTAGTAGTTAGTAACATTTTTGAACGGATGTAGTATTTCACTA
TTTTTGTATCCTCACATGTTCAGCATTCACCTTTGCGGACAAAAAAGGCACATGACATTTTCTTTGAATGTTTGTTACTCTTAGATTGCAGGGGTGTAAT
TCATTGACTATTGACTGCCGTACTGACCACATAAAAACCGCTGCTAAGATGGTGCAAAACAGGGTTCTTTGTTAAAAGATTAGCTATTCTTTTGCATGTA
CTGTGA