Detailed information on CNT30691407


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30519898Oryza sativaSetaria italica28.2419.6591.67144forward
CNT30552828Oryza sativaOryza glaberrima44.7142.14100228forward
CNT30461908Oryza sativaSaccharum spontaneum27.4511.3287.86140forward
CNT30132292Oryza sativaLolium perenne23.7335.1790.91121forward
CNT30595730Oryza sativaOryza meridionalis40.3927.3290.29206forward
CNT30369597Oryza sativaOryza glumipatula21.7644.94100111forward
CNT30109084Oryza sativaOryza longistaminata29.4113.67100150forward
CNT30116075Oryza sativaOryza nivara40.5920.39100207forward

Expression of CNT30691407

Peptides detected in this lncRNA

>peptide 1 (55 aa)
MKPTTRTSARMHAAIPPQHRRRWCSRLWCFSLLMAAATAAAAARASLATSSRVRE*

>peptide 2 (35 aa)
MGPTPPGPAEARVTCAVAEREGSPRSTERSWRSCR*

Sequence

>CNT30691407
GCGGATTAACGCGACCGATGAACTTAATTAATTACCATATTGCCACTAGCCGCTACTCAAATTTGTGACTCACACCTCGACGCTGCACCCTGTCGGCTGC
GTGAACCTGAGCGACGCGACGGCGCCGGCGCCGGTGCCGTTCACGACGGCGGCGGAGGCGCCGCCGAGAGGCATGGGGCCGACGCCGCCTGGTCCGGCGG
AGGCGAGGGTGACCTGCGCGGTGGCGGAGAGGGAGGGGTCGCCGAGGTCGACGGAGCGGAGCTGGAGGTCCTGCAGGTAGAAGGACGGCTTGGAGGGGCG
GAGCGCGAGGTAGACGACGAGCGCGATGAAGCCGACGACGAGGACCAGCGCCAGGATGCACGCCGCCATCCCGCCGCAGCATCGCCGGAGGTGGTGCTCC
CGCTTGTGGTGCTTCTCCTTGCTCATGGCGGCGGCGACGGCGGCGGCGGCGGCGCGAGCTAGCTTAGCTACGAGTAGTAGAGTGAGAGAGTGAGCTGCGA
GCTGTTGCTG