Detailed information on CNT30691396


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SXF8|PIP13_ORYSJ, E-value = 4e-51

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30670956Oryza sativaSetaria viridis42.9328.6183.7319forward
CNT30523825Oryza sativaSetaria italica8.6120.2595.3164forward
CNT30640424Oryza sativaNymphaea colorata43.7439.1180325forward
CNT3019525Oryza sativaCitrullus lanatus9.2931.5188.4169forward
CNT30298239Oryza sativaTriticum aestivum46.8451.5686.49348forward
CNT30393291Oryza sativaTriticum turgidum46.8425.9386.49348forward
CNT30659451Oryza sativaTriticum dicoccoides23.4248.4790.23174forward
CNT30366377Oryza sativaSorghum bicolor45.0967.483.58335forward
CNT30575194Oryza sativaOryza barthii27.59100100205forward
CNT30115924Oryza sativaOryza nivara53.736.1799.75399forward
CNT3050369Oryza sativaCucumis sativus26.9244.3583200forward

Expression of CNT30691396

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MPPNDHAMPWIPTVAHLDADLFTPITVRMLMYRNRNVATNSAIPAR*

>peptide 2 (54 aa)
MAAPRLRAGLMPVPVMGMVARWTRKTAKPMGSGARMGTWESLALRLASVAEKTV*

>peptide 3 (31 aa)
MNLDSIYIFRYIIIECVTFRLVFYRMDGVAK*

Sequence

>CNT30691396
TGAACTAAATTAACGTGTGATTATTAGCAACTACTCCCTCAAATCCCATAAAAAACGAATTTTGTACGATGAATTTAGATAGTATATATATATTCAGATA
CATAATAATAGAATGTGTCACGTTCCGATTGGTTTTTTATCGGATGGATGGAGTAGCTAAGTAGTTGAGAAAGCATTAAATAATGGTTGGTTGCATACGT
GGTCGTGCCATGCGTGGGCGCGGTTATAGACGATGGCGGCGCCGAGGCTGCGGGCGGGGTTGATGCCGGTGCCGGTGATGGGGATGGTGGCGAGGTGGAC
GAGGAAGACGGCGAAGCCGATGGGGAGCGGCGCCAGGATGGGGACGTGGGAGTCCCTGGCGTTGCGCTTGGCGTCGGTGGCGGAGAAGACGGTGTAGACG
AGGACGAAGATCATGCCGCCGAACGACCACGCGATGCCCTGGATCCCCACGGTGGCGCACTTGGACGCCGACTTGTTCACCCCCATCACCGTCAGGATGC
TGATGTACAGGAACAGGAACGTCGCCACGAACTCCGCGATCCCCGCCCGGTAGAACGACCACGACGTCAGCTCCTCCACCTCGAACACCGGCGCCGCCGG
CGGCTCCCGGTAGTCCTTCTCCTCCGCCCCCTGCGCCGCCGTCCCGATCGGCTGCCTCTCCGTGTACCTGTTCGCCCCCAGCCTCACTACTAGCTCTCTT
GCCGGAGCCGGAGACGACGACGACGACGACGACGATGGCGAGC