Detailed information on CNT30691365


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30575168Oryza sativaOryza barthii96.3610097.74265forward

Expression of CNT30691365

Peptides detected in this lncRNA

>peptide 1 (90 aa)
GRGACGRRGGRGWARRGRRAGSRSRRGAGCRRWPWRRRRALDLDLEVYEEEVGFGRRARATSGRRMRKEEAETMRNTMATPIPLPPPTPTP

>peptide 2 (47 aa)
ARSVRTAGRTWMGSTRSKGGKSKSARSGLSSVAMEEEEGPRPRPRGI*

>peptide 3 (40 aa)
GEERADGGADVDGLDAVEGREVEVGEERVVVGGHGGGGGP*

Sequence

>CNT30691365
GGGCGAGGAGCGTGCGGACGGCGGGGCGGACGTGGATGGGCTCGACGCGGTCGAAGGGCGGGAAGTCGAAGTCGGCGAGGAGCGGGTTGTCGTCGGTGGC
CATGGAGGAGGAGGAGGGCCCTAGACCTAGACCTAGAGGTATATGAGGAGGAGGTAGGGTTTGGGAGGCGAGCTCGAGCGACAAGTGGGAGACGGATGAG
GAAGGAGGAAGCCGAGACGATGAGAAACACCATGGCGACGCCGATTCCGCTTCCTCCTCCGACGCCGACTCCGAC