Detailed information on CNT30691349


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552667Oryza sativaOryza glaberrima68.3441.1198.77326forward
CNT30100358Oryza sativaOryza rufipogon101.4740.597.73484forward
CNT30575146Oryza sativaOryza barthii99.3756.799.16474forward
CNT30116022Oryza sativaOryza nivara68.3442.2898.77326forward

Expression of CNT30691349

Peptides detected in this lncRNA

>peptide 1 (72 aa)
QTNTRQTLPNSNHGLVSHTPQLSAALVLAGGGGGAVASSGFLWPPGSFSLILSRKPFFSSSGARGRVASVLA*

Sequence

>CNT30691349
CCAAACTAACACACGCCAAACACTTCCAAATTCCAACCATGGCCTGGTCTCACACACGCCCCAATTAAGCGCTGCTCTTGTGCTCGCCGGTGGCGGCGGC
GGCGCAGTTGCGTCTTCCGGCTTCTTGTGGCCGCCGGGCAGCTTCTCCTTGATCTTGTCGAGGAAGCCCTTCTTCTCCTCCTCGGGTGCACGTGGCAGGG
TCGCCTCCGTCTTGGCGTGATCACCCTCGATCTTCTCCACGGGGACGGCGGTGTCGTGGTGGTGATCGCCGTGAGTCACCACGGGAGCAGGAGCTGGCGT
GGGCGCGGCCGTCACCACGGATGCAGCCTCGCCACCCTGGTGGCTCTCCGTGTTCCTCTCATCCTCCATGATCGATCGATGGATTCAGCTAAAGCCTCTC
GAGAACTAAAGTAATCAAACAACAGATCAGCAAGAACTATTCGCTCTTGACTTGTTTGAGCTGTGACGAGTCGCTTT