Detailed information on CNT30691322


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30595828Oryza sativaOryza meridionalis44.5851.9390.54148forward
CNT30369655Oryza sativaOryza glumipatula44.8843.4499.33149forward

Expression of CNT30691322

Peptides detected in this lncRNA

>peptide 1 (39 aa)
KRSSSSPPEGPPAAAAAEKLGLGDDAAAEDGSMARPWSG*

>peptide 2 (66 aa)
MGRLVPLRPPLQYATPATRRPVGRRRRRRRLGGLGLVRVGKRGRRADDDRRGGWVGLGGDGGVASPL

>peptide 3 (90 aa)
EEVELLATGGATGGGGGGEARVGRRRRGGGRVHGEAVVRVVERHGAAGASPPPSPVRDSGDAATGGSSAAAAAVGGVGVGASGEEGKKSG*

Sequence

>CNT30691322
GAAGAGGTCGAGCTCCTCGCCACCGGAGGGGCCACCGGCGGCGGCGGCGGCGGAGAAGCTAGGGTTGGGCGACGACGCCGCGGCGGAGGACGGGTCCATG
GCGAGGCCGTGGTCCGGGTAGTGGAACGCCATGGGGCGGCTGGTGCCTCTCCGCCCCCCTCTCCAGTACGCGACTCCGGCGACGCGGCGACCGGTGGGTC
GTCGGCGGCGGCGGCGGCGGTTGGGGGGGTTGGGGTTGGTGCGAGTGGGGAAGAGGGGAAGAAGAGCGGATGACGATAGGAGAGGAGGTTGGGTTGGGTT
GGGTGGTGATGGTGGGGTGGCGAGTCCACTGC