Detailed information on CNT30691303


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT003266, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30108168Oryza sativaOryza longistaminata53.5471.8697.191673forward
CNT30100211Oryza sativaOryza rufipogon12.9980.24100406forward
CNT30575176Oryza sativaOryza barthii14.8870.56100465forward
CNT30115971Oryza sativaOryza nivara63.8491.5699.81995forward
CNT30550641Oryza sativaOryza brachyantha14.5627.983.74455forward

Expression of CNT30691303

Peptides detected in this lncRNA

>peptide 1 (84 aa)
MRTYPFLQRTVSLLSRVYNDWPKEVSTDFTVLRDVLTSCKVQSKLSVKLIVTNNIDSFTIVYPVITFLSVMLWKIQLYPTTMET*

>peptide 2 (63 aa)
MKYPVQRRQATNQQSTTKLFKQFKMEPTLITLPCLQFCLELTFKRGTYFMVTCQFRISFQFQE*

>peptide 3 (56 aa)
MNCTVYDNIRGSIVFLFTKIQLCRVEVARVYKRLFLRNRNTKYVCYIPVLVRASIQ*

>peptide 4 (52 aa)
MNNMPASNASLEFHMFESLKITKVYYVLQLMKKYFQIITNKTQTRNVNRTWRV

>peptide 5 (31 aa)
MFESCKAFLLFSFSEVLTMKGGQNKGKPQRM*

>peptide 6 (29 aa)
MEEVYENTYNISIGKDLTWSNALETTARN*

>peptide 7 (35 aa)
MQSITSTSVLASLFLNPPQSFTSSLLKIPYYKVIV*

>peptide 8 (33 aa)
MYDIDRLGCNTHVKGKTIRFYRVKLFGKQVSYQ*

>peptide 9 (36 aa)
MISNLPPCDSDTRVPLKSMAYHQIPNLKSGSSQANE*

>peptide 10 (35 aa)
MEGVRFEILPPQCYENISLFTENSQSSQQSLQRLA*

>peptide 11 (42 aa)
MDPSESSEGKFSLLSVQLVGSFSLEPAETINSALLDFYAVVS*

>peptide 12 (40 aa)
MKTPIIFLLVRTSLGQMLWRLLLETKWTCGKLVTIENNKN*

Sequence

>CNT30691303
GCAAGAGAAGTACACAAATTAAGAACAAGATGGTAACACCGACATAGGTTCCTACAGCAGCAAAATACAATACAGGTAGCAGGCACCATGGTTAAATAGG
TTACATACAATGCTTGGATATAACTCAGACAACTAAAACCTATCGAGTGAATATCTCAGGCAGCCTGTCCGCCCAAGAGACAAGCCCACGGACTAATGGT
TGGCCTACAAGGGCAGATCGATCTGGCGATTCTGAACTAACCTACTACTATACTCACTTTGAAAGGACTGTGTTCTAGTTACAGGTAACCAGGTCTTCAG
CTTCACCATCCTACAACTACTATGATCACTGCTCACATTGAAAGGACTGTGTTCTAGTTACAGGTAACTAGGCCTTTAGCTTCGATCACCATGGACCCGT
CAGAGTCCTCCGAAGGCAAATTCTCTTTGCTGTCGGTCCAACTTGTCGGCTCATTCTCTCTAGAACCTGCAGAAACCATTAACAGTGCATTATTAGACTT
TTACGCGGTGGTGTCTTGAAGCCAGAGGAAAATCTCAAACTAGGAAACGAAAAGCTTGGAAACTTCTCTCCCAAATTTACCAGGAACAATTGTCAGATAG
TATGCTGACAGAAAAATAAGGAACCCCATTTTGAAGTCATTAAAACCCAACCAAAGGACAACATAAATTAAATAGAATTGAGTGGTGATTTGCTTTTTCA
AAAATGAATTGTACAGTTTATGATAACATCAGAGGCTCCATTGTTTTCCTTTTTACCAAAATACAATTATGTCGAGTAGAAGTGGCAAGAGTCTACAAGA
GGCTCTTTCTCAGAAATAGAAATACCAAGTATGTGTGCTACATACCAGTATTAGTTAGAGCAAGCATTCAGTAATTCAGTTTTTGTCCAATCCACATTTT
TTCAGGGTTAGAGTAGCCTCTAAAAAACTGATGATTCTAAGTTTCAAACCATTTGTGGCACTCCCTTAGCTTCTGTACACATTCAAACTAGTGGTCTAAG
ATGTGGAAAAACAACTAGGACATGGAGGGAGTGCGGTTTGAAATTCTGCCGCCTCAGTGTTATGAGAACATATCCCTTTTTACAGAGAACAGTCAGTCTT
CTCAGCAGAGTTTACAACGATTGGCCTAAGGAGGTATCCACAGATTTTACAGTGTTGAGAGATGTGTTAACTTCATGTAAAGTTCAGTCAAAATTGTCAG
TTAAATTGATTGTAACAAACAATATTGACAGTTTCACAATTGTCTATCCTGTCATAACTTTTTTAAGTGTTATGTTGTGGAAAATACAGTTATACCCCAC
TACGATGGAAACATAGGCATTAAACTATACACACATCAAATAACTGTTTTTTGAATAAACTTTAATATTTGCTTGCCCTTCCAATGTTGCATTTAGTTAA
AACTGTATTATTATAGATGAAATATCATTTAAATGGTTATAATTCAACAATGATGGCAGTTGACTGATCAATTCAAAGAATTTCTTTTTTAGTTTAAGCC
ATTTAAATGCTGCCACCTAACCCCTGATGTAGGAAAATGCAATCAATCACATCGACATCAGTCCTTGCCTCATTATTTCTCAACCCCCCACAAAGCTTTA
CTTCATCATTGCTTAAAATCCCATACTATAAGGTAATAGTGTGAAAGCCAAAACTCACGACCAGTAGCTATCAATCAGAACATAACGTTTGACATTCAAA
CAAGTGAATCAATAATTGTTAATATACACAGCATACATTTTCCTAACAATAATTGTTAAAATTCACACCATACATTACGAGCGAAAAATAATCATAGAGC
AGAGCATATGTATGATATTGACAGATTAGGCTGTAATACTCATGTAAAGGGTAAAACTATCAGATTTTACAGAGTAAAACTTTTTGGTAAACAAGTAAGC
TATCAGTAAAACAGAGCATGCCTAGGTTGCACAGCTTCGTTTTGTTTCTTGTTTGACATTAATAAGCAAAACATAGTACCTATCCAGAGCAAAAGATTTT
TTTTCCAAGATAAGCAATTACCTCATTCTTTTGCTGCTCCAACATTTCATCCTGCACATTAGAATACATAAAAATAAGTTCAAATGCTAAAGCATAATCA
AATGAATAGAGTAGCTACTGCCTACTAGTCCACTATCCTAAGGGAATAGAATTGTCAGGTCTTAAGGCACTTATGTTTGAATCATGTAAAGCCTTTCTTT
TGTTTTCCTTCTCAGAAGTACTTACCATGAAAGGCGGACAAAACAAGGGCAAACCTCAAAGAATGTAATAAGACAGTGCAAAATGAAATAATCACAATTG
TGGGTGTGGGTGCAATGCAACATTCATAAGTACTATTTTAGTTAGACTTGCAATTAAGATGCATGATAAGCTACGTATATTACAATTTATAAAATGAAAT
ATCCTGTACAAAGAAGGCAAGCAACTAACCAGCAGTCCACCACCAAACTATTTAAACAGTTTAAAATGGAACCGACTTTGATTACTCTACCATGCCTTCA
GTTTTGTTTAGAACTAACTTTCAAGCGTGGAACATATTTCATGGTAACTTGTCAGTTTAGAATTAGTTTCCAATTTCAAGAGTAGACTATAAAGTAAGGG
GCTACACTAGAGTATAGCGTCAATACAACTTCTGTCACTAAAAGAGTGGTATTGTCTATGTTCATAGCTAAAAAGATACTCTTTTAAGGATGGAGGAAGT
ATATGAAAACACCTATAATATTTCTATTGGTAAGGACCTCACTTGGTCAAATGCTCTGGAGACTACTGCTAGAAACTAAGTGGACATGTGGCAAACTAGT
GACAATTGAGAATAACAAAAACTGATAGTTTAAGATTTCAAAACAGCAATTTTTTTAGTTTGATGATTAGCAACTTGCCACCATGTGACAGTGACACAAG
GGTCCCTCTGAAATCAATGGCGTATCATCAAATCCCCAATCTAAAGAGTGGCAGTTCACAGGCAAATGAATAATATGCCAGCATCAAATGCTTCATTGGA
ATTCCATATGTTTGAAAGTTTAAAGATTACCAAAGTGTACTACGTACTTCAACTCATGAAGAAGTATTTCCAAATTATAACGAACAAAACTCAAACTAGA
AATGTAAACAGAACATGGAGAGTAC