Detailed information on CNT30691250


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30107196Oryza sativaOryza longistaminata24.2943.5598.32179forward
CNT30100205Oryza sativaOryza rufipogon72.8685.5199.81537forward
CNT30575186Oryza sativaOryza barthii45.5962.3495.83336forward

Expression of CNT30691250

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MRIRPTASDDPVICCPEVCCIQLLLLIDLA*

>peptide 2 (41 aa)
MACKHRTTQLWVPIKASTWECAKLSCIWNWPFKVIVRNVEC*

>peptide 3 (48 aa)
KIRPGPVKVQSARHPPSPRPAPPPPPPRHARRCSPTPVAESSPLSRPA*

Sequence

>CNT30691250
CAAAATAAGGCCGGGCCCAGTTAAGGTCCAATCTGCCAGGCACCCTCCCTCCCCGCGGCCGGCGCCGCCGCCGCCGCCGCCGCGCCATGCCCGCCGGTGC
TCCCCGACTCCGGTCGCCGAATCGAGCCCGCTCTCCCGCCCGGCCTGATCCCTCGCGCTCACCGTAGAATCATTTCCGCGCCAATGCGCGATCTTCTGTT
CCTGCCTGCCGCTCTAGGATAACCGTCTCCACTTCCATTTGGGAAACCCTAGAAGTTTATGCGGATACGGCCGACGGCCTCGGATGATCCAGTGATCTGC
TGTCCAGAGGTATGCTGCATTCAGTTATTGCTGTTGATTGATCTGGCTTAAGCTTGGGCTATAAGAAATCATCAGACCATGGCCGGAGATAGTGACAGCT
ATCATTGTGTCACAGGTCTTGGTTGGTTTGCGACCTAACTGAAGTAGAGCTAGAAAAACCTTGATAGGACAATCTGATCATATAACACCCCTACAGCAAA
GAATGCACCAAAGGAAATCATAAAGACAAATGATGATACAACCTTGTCAGCATTTTGTTTTGTGGAGACAAATGGTGTTTGTGCTAAACCACAATGGCGT
GCAAGCATAGGACCACACAACTTTGGGTTCCCATCAAAGCTAGTACTTGGGAATGTGCTAAGCTGTCCTGCATTTGGAACTGGCCCTTCAAGGTCATTGT
TAGAAATGTTGAATGCTGAAAGGAAGTGAAGTTTGTT