Detailed information on CNT30691199


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30691199

Peptides detected in this lncRNA

>peptide 1 (32 aa)
RAFQQGIQSVIENKNIKEISFLFIYAQCQQKL*

>peptide 2 (30 aa)
MFFFILNLESLAEQNGRLREYFRAEGSLPN*

Sequence

>CNT30691199
CGAGCATTTCAGCAAGGAATCCAATCGGTAATAGAGAACAAAAATATTAAGGAGATCAGTTTTTTATTTATTTATGCACAGTGCCAACAAAAACTATGAA
ACCACTTAAAAATTGTTACGGAAAAGCTAGTGAGTGTGTTCTAGTTTCTCTTTAGCATCTACTAACACCGTAATAAATATAGATTGCTAAATCTTTATAT
AGTTTCAACTACACCAGACATTGAAATACTTGTACTTAAGTTGTTTGGAATTAAGGATTGGTCACAACCAAAATGGATACTTGACTTTGGATATAGTTAT
CCATTACTCAAATCGAGAAATGTTTTTTTTTATCTTAAATCTAGAATCGTTAGCAGAGCAAAACGGTAGATTACGGGAATACTTCAGAGCAGAAGGAAGC
TTACCAAATTGACTCCAGGGAGTATGTAACTAGCTAGCCTGTCATCAATCGAAACTGGCAGCGGAGGCATTTTGCTCATTATCCCAGGCATTTGGCTCAT
GCTGTTTA