Detailed information on CNT30690921


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 1e-97

BLAST vs NONCODE:
NONMTRT002042, E-value = 3e-41

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30190515Oryza sativaSecale cereale27.8453.4693.08448forward
CNT30301827Oryza sativaTriticum aestivum28.960.1692.69465forward
CNT30225892Oryza sativaHordeum vulgare25.2366.6793.6406forward
CNT30395844Oryza sativaTriticum turgidum29.0930.2592.74468forward
CNT30242975Oryza sativaAvena sativa28.963.0192.47465forward
CNT30141380Oryza sativaLolium perenne28.950.1692.47465forward
CNT3067606Oryza sativaLeersia perrieri29.0226.3289.94467forward
CNT30349330Oryza sativaEragrostis tef29.0930.1991.88468forward
CNT30150477Oryza sativaBrachypodium distachyon29.0934.9891.67468forward

Expression of CNT30690921

Peptides detected in this lncRNA

>peptide 1 (62 aa)
MSKKNYPTDLHQTQNRYNILKPVFAPTHGTNNSIKSGTVDLNMLATRPTRWNTLQIAPITQA*

>peptide 2 (47 aa)
MRRCWSGGMPSLSWILALTLSMVSEDSTSRVIVLPVNVFTKICICKK*

>peptide 3 (52 aa)
MRRCWSGGMPSLSWILALTLSMVSEDSTSRVMVLPVSVLTKICMPPRRRRTR*

>peptide 4 (45 aa)
MSSQRSASARNNHQTDRVRTSTRLRTQQRIKQQTYSNRTYMYSKR*

>peptide 5 (35 aa)
MEHATNRTNHSGMTSSTIPQQIYTDFPNRIIQQFI*

Sequence

>CNT30690921
CACATATTTAGGTTCAAATCCAACTTATTCATAAAGCATACTGCTGTCCCACAGGAAACTGTTTCATAAAACTAACATATCATACGGACTCGATGGTCCA
TTAAACCAGACACAAGTAGACATCAGCACCACAAATACTTGACGAACAGAGGCTCGGGACGACCAGGCACATCGGCAGCTCCACCAAACTGGCTGATTAC
TGACCACCACGGAGGCGGAGCACCAGGTGGAGGGTGGACTCCTTCTGGATGTTGTAGTCAGCAAGGGTCCTGCCATCCTCCAGCTGCTTGCCAGCAAAGA
TGAGACGCTGCTGGTCCGGGGGAATGCCCTCCTTGTCCTGGATCTTGGCCTTGACGTTGTCGATGGTGTCAGAAGATTCCACCTCGAGGGTGATGGTCTT
GCCGGTCAGTGTCTTGACAAAGATCTGCATGCCACCACGGAGGCGGAGGACAAGGTGAAGGGTCGACTCCTTCTGGATGTTGTAGTCAGCAAGGGTCCTG
CCATCCTCCAGCTGCTTGCCAGCGAAGATGAGACGCTGCTGGTCCGGGGGGATGCCCTCCTTATCTTGGATCTTAGCCTTGACATTATCGATGGTGTCAG
AGGACTCCACCTCGAGGGTGATAGTCTTGCCGGTCAATGTCTTCACAAAGATCTGCATCTGCAAGAAATAATCACCAAACAGATAGGGTAAGAACTAGCA
CAAGATTAAGGACACAACAACGGATCAAACAGCAAACATATTCCAACAGAACATACATGTATTCAAAAAGATAGTAACAGGCACATCACACATGTATTCA
GATAGGTAGTAACAGCACACGTATCCTGAACTTCAGAAATAAGTAGAATGAACTAGTGGCAATAATCTTCACACAGATAGTAAAAAGAAATTACCACAAT
AGATTATATAGATGAACTACAGATTGTAACATGATATTACTACAGATTGTAACATGATATTCTAATATAGTTCTTAGCATAAATTACTGGCAGATAGTAA
CATGAGATCATTATGACAGATATAGCGACAAGACTTCCTATTTACCATTGACAATTAATTAAAAGAGTTCATCATTATCTAATCTGTGAACATATGAAAT
CAAATCGAAACGCACAAGCTACATAATTGAACCATGTCTAAGAAGAACTACCCTACAGATCTACATCAAACACAAAACAGATATAACATATTAAAGCCTG
TGTTTGCACCAACCCATGGCACCAATAACTCAATCAAGAGCGGAACAGTAGATCTGAACATGCTCGCAACAAGGCCTACAAGATGGAACACGCTACAAAT
CGCACCAATCACTCAGGCATGACTAGTTCCACAATTCCCCAACAGATCTACACCGATTTCCCCAATCGAATCATCCAACAATTCATCTAACCGTAAAAAT
TCCCCCCAATCATCAGAACCAACATCCAATCCCAAAACCTAACCACGATTCCACCTATCGAACCAACCGTGCCCAAATCACAACCATCAGATCTACAACC
CCTAAACATCTCACGATAATCACATCGACAACCCTAACCACCAATCGGATCTAGCAACAAAACAACCTCACCCGTCCGAAATCGAATCGAAACGAAGCGA
GGAGAGGAG