Detailed information on CNT30690910


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9FKL6|CB60B_ARATH, E-value = 5e-30

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30520035Oryza sativaSetaria italica57.6650.9983.28335forward
CNT30131847Oryza sativaLolium perenne33.0528.8783.85192forward
CNT30364715Oryza sativaSorghum bicolor57.3139.4581.38333forward
CNT30595706Oryza sativaOryza meridionalis62.6572.3798.35364forward

Expression of CNT30690910

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MRSRLPSGWLTRHPCSKSATSVASLRSPISRGSAS*

>peptide 2 (32 aa)
MLLLWWSQCQYIGAPRNLILQCGTIELAFRCQ*

>peptide 3 (31 aa)
AALILSHPTTAFPGGRARSSPKLKLGGVDGM*

Sequence

>CNT30690910
GCTGCCTTGATCTTGAGCCACCCGACGACGGCTTTCCCAGGTGGGCGGGCACGGTCATCCCCAAAGTTGAAGTTGGGGGGAGTTGATGGCATGTAGTTAG
GAAATGCGAAGCCGTCTTCCGTCAGGTTGGTTGACGCGCCACCCATGCTCAAAATCCGCAACATCTGTTGCATCTCTTCGTTCTCCAATATCTCGTGGCT
CCGCATCCTGATCTCCTCCATCAGGTAGTCGTCAACCCCACTCCGGTTCTCCTGCGGTTGCGACCAGTCATCGAAAGGATTCAAGCCGGTGGGCTGCATG
GACTGGCCACCTAGTGCTGAGAATTCAAAATTTTGCTGATGTTGTTGCTGTGGTGGTCCCAATGCCAGTATATTGGAGCCCCTAGAAACTTGATTCTGCA
GTGCGGAACCATTGAACTGGCTTTCAGGTGTCAGTGAACTCCGCTCATATTGTGTAGTGACGTTTGCAGGTATGCTTTGAGAATTGACTGCATATCGTCC
TGCCTGATTTCCATTGTATGCACTTGTAGATCCATCTGCTGAAAAGACCAAAGGAATTCAGTAGCGCAATGTATTAGTAAT