Detailed information on CNT30690874


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676755Oryza sativaSetaria viridis28.8520.6188.6488forward
CNT30523711Oryza sativaSetaria italica44.9233.9185.4137forward
CNT30640866Oryza sativaNymphaea colorata44.2616.2881.48135forward
CNT30295690Oryza sativaTriticum aestivum46.5624.1985.21142forward
CNT30351740Oryza sativaEragrostis tef34.7514.183.96106forward
CNT30595486Oryza sativaOryza meridionalis27.2114.997.5983forward
CNT30100513Oryza sativaOryza rufipogon50.1627.37100153forward
CNT30575412Oryza sativaOryza barthii98.6943.0698.34301forward

Expression of CNT30690874

Peptides detected in this lncRNA

>peptide 1 (85 aa)
EKVIKHINRSFLRSFDRDRSSIGRRRASWRPSSRGARGRRTPRRPARPPPPPPPSPCARARSPCPSSPGASRGGASSPQPWLATH*

Sequence

>CNT30690874
GGAGAAAGTAATTAAGCATATAAACCGTTCGTTCTTGCGTTCATTCGATCGGGATCGATCTAGTATTGGTCGGCGGCGTGCTTCTTGGCGTCCTTCTTCT
CGTGGTGCTCGTGGAAGGCGAACCCCGCGGCGCCCAGCGCGGCCACCGCCGCCACCTCCTCCTTCACCTTGTGCCCGTGCGCGTTCTCCGTGTCCTTCTT
CGCCTGGTGCTTCTCGTGGTGGTGCTTCTTCTCCTCAGCCATGGCTAGCTACTCACTGATTAATAATCTTAGCTTCCTTCAGACAGAGTTAGTCGGTTGC
CGGTG