Detailed information on CNT30690800


BLAST search results

BLAST vs Swiss-Prot:
sp|A2WK50|IBBR_ORYSI, E-value = 2e-89

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552364Oryza sativaOryza glaberrima92.2870.2298.64514forward
CNT3099845Oryza sativaOryza rufipogon76.6680.57100427forward
CNT30603558Oryza sativaOryza punctata20.4713.6784.21114forward

Expression of CNT30690800

Peptides detected in this lncRNA

>peptide 1 (62 aa)
MSGPGNGPGASLHDLHAAEHCFTSSLQRYSGGKISSGDISMLSQQSQGLGGRGGASAPSLGRR

>peptide 2 (34 aa)
MQRQVGGFILLQKALSQHFPHGRGVHKGPGSAPQ*

Sequence

>CNT30690800
CTAGCCTCTAGCTATACCAACTCTGAATGATCGAACGAACGATCAGCTAGCTGCAAGCTAGGGCGAGTTTTATTGATGGACACACAGATCGATCATCGAT
CATCTGTAGCTAGCTAGTTCTCCGCTCGGGGTTTGCACATGGGCCCGGGCTGGCCGGTGAAGCGGTCCTTGCAGACGTAGCGAGGCGGCTCTGACGACTC
CACACGCTGGCAATCCTTGCACGCGGCGGCGCACTTGTTCACCTCGTCCATGCAGCGGCAGGTCGGCGGGTTCATCTTGTTGCAGAAGGCCTTGTCGCAG
CATTTCCCCCATGGCCGCGGCGTGCACAAGGGGCCCGGGTCGGCGCCCCAGTAGACGTCCTCGCAGATGAGCGGCCCCGGGAACGGCCCCGGCGCCTCCC
TGCACGACTTGCACGCGGCGGAGCACTGCTTCACCTCGTCGTTGCAGCGGTACAGCGGCGGGAAGATCTCGAGCGGGGACATCTCGATGTTGTCGCAGCA
GTCCCAGGGTTTGGGCGGGCGTGGTGGTGCTTCGGCGCCGTCGCTTGGGAGACGGAT