Detailed information on CNT30690674


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552118Oryza sativaOryza glaberrima92.0710099.63267forward
CNT3099801Oryza sativaOryza rufipogon10055.03100290forward
CNT30575067Oryza sativaOryza barthii98.6282.6699.65286forward

Expression of CNT30690674

Peptides detected in this lncRNA

>peptide 1 (32 aa)
SDGPPLRRPEMSSMRELELNPRSSRSSAWWKW*

>peptide 2 (36 aa)
MTACARSWSVPGCGVSWSRNPSSNLLSARSPLVGQCR

>peptide 3 (34 aa)
MVVGAGFGSVTSNDGLRTELERSRLRRLLVEESK*

>peptide 4 (35 aa)
VGRAAAPAAGDVLDEGVGAEPTVEQVLGMVEVVEL*

Sequence

>CNT30690674
TGTCGGACGGGCCGCCGCTCCGGCGGCCGGAGATGTCCTCGATGAGGGAGTTGGAGCTGAACCCACGGTCGAGCAGGTCCTCGGCATGGTGGAAGTGGTA
GAACTCTGAGCCGCCGAGAGGGGATTCCTTGCCGTTAGCTATGGTGGTGGGTGCTGGTTTTGGCTCGGTGACTTCGAATGACGGCCTGCGCACGGAGCTG
GAGCGTTCCAGGCTGCGGCGTCTCCTGGTCGAGGAATCCAAGTAGTAATCTCTTGTCTGCAAGGAGCCCCCTGGTGGGTCAATGTCGGCG