Detailed information on CNT30690616


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT002395, E-value = 5e-147

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30111296Oryza sativaOryza longistaminata21.8660.7699.58240forward
CNT30117469Oryza sativaOryza nivara14.3955.2495.57158forward

Expression of CNT30690616

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MFLCFTFMGKIPRGPKLPFILLCFCCGLN*

>peptide 2 (98 aa)
MSLLHPSICISSSALYCFALPHACCHVDVLLLTNTSLLQFSFFVQAIALPLNLTFFAGPLNLTYFSVLYTDSVTGHIVPGDETRENRLHQASVNVHSA*

>peptide 3 (60 aa)
MAVLLSMKALLLVYFFILPVQDPHWSSRPRNGSASIGLQQGDTPAPRLLDSGVCQEAAIK*

>peptide 4 (48 aa)
MLHFHGKNTKRTKAAIHTAVLLLWIELAGEKNAHELINGPFPVATSSH*

>peptide 5 (40 aa)
AEVNHMRQNGSLAFNESLVAGIFLHFASARPTLVFQTTEW*

Sequence

>CNT30690616
GCTGAGGTGAATCACATGAGACAAAATGGCAGTCTTGCTTTCAATGAAAGCCTTGTTGCTGGTATATTTCTTCATTTTGCCAGTGCAAGACCCACACTGG
TCTTCCAGACCACGGAATGGTAGTGCATCAATAGGGCTGCAGCAGGGTGACACACCAGCACCACGGTTATTGGATTCAGGAGTTTGCCAAGAAGCAGCAA
TTAAATGATTAGCTTCCACCTTTAATTTTGCTGGCAGGTAGTCTGTCGACGGCTTCTTTTTTCCAGTTATGGCAATGTAGCTATTCTTATCAATTCCTCC
CCTTTCTGCTATTGCCTGATTGTGCAGGTGTTATCCCAGGCTTCATGGACAACTCCGTCGCCTTGAGGAAATGAGCCTCCTCCATCCCTCCATATGTATT
TCCTCCTCTGCTCTGTACTGCTTTGCTCTGCCTCATGCTTGCTGTCATGTGGATGTGCTGCTGCTGACCAATACTAGCTTATTGCAGTTTTCCTTTTTTG
TTCAGGCCATTGCATTGCCTCTGAATCTTACTTTTTTTGCGGGGCCTCTGAATCTTACTTACTTTTCAGTGCTATATACAGATTCAGTTACAGGACACAT
AGTTCCTGGAGATGAAACAAGGGAAAATAGACTGCACCAAGCATCAGTTAACGTACATTCAGCATAAGAGAGTTAAGCCCACTACCTAGCCGGCTCTTTG
TTGCCAACTTATTGTGACTACTTTCGATTTTGGTGCAGTAGTTTTGGTGATGACAAAAGCTACAATTATTCAGGGCTGTCATTCTCTCCTGCAGGAGTGG
CAAAGAATTTTATAGGATTCAAATTCCAACGGATTTTTCTTCCTATGTTTCCCTTTGGCTTATAGGACTATGTTCCTATGCTTCACTTTCATGGGAAAAA
TACCAAGAGGACCAAAGCTGCCATTCATACTGCTGTGCTTTTGTTGTGGATTGAACTAGCAGGAGAGAAGAATGCACATGAACTTATAAATGGACCATTT
CCGGTAGCCACGAGTTCTCACTAGAAAAAGGCAGCTACTTTATTTGTCCTGTATATTAGTATATTGTTTATTAATCAATGTAAATGATCACTGACGGA