Detailed information on CNT30690606


BLAST search results

BLAST vs Swiss-Prot:
sp|P06671|CB22_MAIZE, E-value = 4e-137

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30186721Oryza sativaSecale cereale5346.3293.48460forward
CNT30285424Oryza sativaTriticum aestivum5364.6194.57460forward
CNT30395272Oryza sativaTriticum turgidum53.3448.9994.17463forward
CNT30443381Oryza sativaAegilops tauschii46.241.4391.27401forward
CNT30656613Oryza sativaTriticum dicoccoides74.0873.1590.98643forward
CNT30470687Oryza sativaSaccharum spontaneum74.5481.1893.35647forward
CNT30684601Oryza sativaTriticum urartu63.2557.1391.26549forward
CNT30345518Oryza sativaEragrostis tef64.7568.8791.99562forward
CNT30369334Oryza sativaOryza glumipatula55.350.9100480forward
CNT30574765Oryza sativaOryza barthii10097.8699.19868forward
CNT30582834Oryza sativaEchinochloa crusgalli74.4267.4391.8646forward
CNT30603531Oryza sativaOryza punctata49.6539.5496.75431forward
CNT30556694Oryza sativaPanicum hallii68.261.9291.22592forward

Expression of CNT30690606

Peptides detected in this lncRNA

>peptide 1 (39 aa)
YAERGERRASHRSLHESNGPHRRCSPEIHTHLPGTKLVA*

>peptide 2 (45 aa)
TRKEENVARLTAACMKAMDLTAVARRRSTLTCRGRSWWRRPMRCC*

>peptide 3 (29 aa)
MAHRQWITSSSRFLANVSGSADSPAVSQP*

Sequence

>CNT30690606
GTACGCGGAAAGAGGAGAACGTCGCGCGTCTCACCGCAGCCTGCATGAAAGCAATGGACCTCACCGCCGTTGCTCGCCGGAGATCCACACTCACTTGCCG
GGGACGAAGTTGGTGGCGTAGGCCCATGCGTTGTTGTTGACGGGGTCGGCGAGGCGGCCGTTCTTGATCTCCTTCACCTTGAGCTCGGCGAACGCCTCGG
GGTCGTCGGCGAGGCCGAGCGGGTCGAAGCTGCCGCCGGGGTAGAGCGGGTCGACGACCTCGCCGAGCGGGCCGCCGGCGACGCGGTACCCCTCGACGGC
GCCCATGAGCACGACCTGGCAACCCCAGATCGCCAGGATGCTCTGCGCGTGGATCAGGCTGGGGTTGCCGAGGTAGTCGAGCCCCCCCTCGCTGAAGATC
TGGGACCCCGCCTTGAACCACACGGCCTCGCCGAACTTCACGCCGTTGCGGGCGAGGAGCTCCGGGAAGACGCAGCCGAGCGCGCCCAGCATGGCCCACC
GGCAGTGGATCACCTCCAGCTCCCGGTTCTTGGCGAACGTCTCCGGGTCGGCCGACAGCCCGGCGGTGTCCCAGCCGTAGTCGCCGGGGAACTCGCCGGT
GAGGTAGGACGGCGGCTCGCCGGAGAGCGGGCCGAGGTAGAGCACGCGGTCGGCGCCGTACCACGGGCTCCCCGACGCCGCGGCGGGCTTGGGCTTGGCC
GCCGACTTGCGCATCGTGACGCGGCCCTCGCCGAACACCTTGGCATTGGCGACCGCCTTGCCGGCGAGGGCGGCAGGGGAGGAGAGTGCCATGGTGGACG
CCGCCATTGACGCGAGCCTAGGACTAGGAGGAGATGGCCACAGATGCTTTTGGAATGTGTGTCTTTTG