Detailed information on CNT30690356


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004332, E-value = 5e-79

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30109097Oryza sativaOryza longistaminata38.5775.6897.74442forward

Expression of CNT30690356

Peptides detected in this lncRNA

>peptide 1 (99 aa)
RRRPSARSDETRRTRPLLPPSGKPLTCVCKANAPASVSPACKADHRSRRGQPVAAAPCQSRRPKRQGETDRSWLPLPVPCTSLCKAGKADAALAFPLPR*

>peptide 2 (58 aa)
MRTTYLLICQVCCMDVITMLWMRVLATDHGTSTVYAPGIREFNPRVPTCIAVIVVYTM*

>peptide 3 (34 aa)
MGIPKNLCIFTFSTAFKLFYLAGRPNYYVRPMHR*

>peptide 4 (86 aa)
TPPLCPERRDATNPTVAASVWKATDLRLQSKRPCLRVSRLQSRPPQPPWPTRSRRPLPKPTPEATRRDRPLLAPTACPLHLPLQSR*

>peptide 5 (65 aa)
MQDVRCLVTITLHRVPEFLRMVLSRVIPSRLPVWFGRWAYRRTYVSLPSPLRLNSFIWPVGLTTM*

Sequence

>CNT30690356
CGACGCCGCCCCTCTGCCCGGAGCGACGAGACGCGACGAACCCGACCGTTGCTGCCTCCGTCTGGAAAGCCACTGACCTGCGTCTGCAAAGCAAACGCCC
CTGCCTCCGTGTCTCCCGCCTGCAAAGCCGACCACCGCAGCCGCCGTGGCCAACCCGTAGCCGCCGCCCCCTGCCAAAGCCGACGCCCGAAGCGACAAGG
CGAGACCGACCGCTCCTGGCTCCCACTGCCTGTCCCCTGCACCTCCCTCTGCAAAGCCGGTAAAGCCGACGCCGCGCTAGCCTTCCCTCTGCCCCGCTGA
CACCGTGTCATCCGCCGACCCCGTCTGTGCGCGCACGAGACGCCGAACGCGTCACGACAACCTCCGCGTCCGCCTCTCGCTCCTCCCTCGCCTATAAATC
GAACCCTCGCGCCAGCTAACTCTCCACACCACTCTCAACCTCCACACCCAAAGCCGAAGACCAAAACCCTCTGATTCGCCGGGAACGCCCGCGCCATCGT
CACGCCCCGCGTCGGCCGAACAGGGCGCGACCGCCAACCCGCACCCGTCAAGTCGCTGCCTCGGACCTCTTCGCCGGAGATCTGCCGCCACCATTGCCGT
CGCCGACCGCCTAGGGAGCTCGTGGCCACGCCACCTCGGACCGCCTCCGCCCAAATAGAGCACGGGAGGGCGAATCGATTGTTGCCGTTGGCGAAAGTGT
GCAGGACCAAGAGTTATTTGAGGAACCAACTAAGCAAGACATGGATGCAGGATGTGAGGTGCCTAGTGACGATTACTTTGCACCGGGTACCGGAGTTTTT
GAGGATGGTTCTTTCTAGGGTGATTCCTAGTCGGTTGCCTGTGTGGTTTGGTAGATGGGCATACCGAAGAACTTATGTATCTTTACCTTCTCCACTGCGT
TTAAACTCTTTTATTTGGCCGGTCGGCCTAACTACTATGTAAGACCTATGCACCGTTAAGTTATGAGAACCACTTATCTACTTATATGTCAAGTATGTTG
TATGGATGTGATAACAATGTTGTGGATGCGTGTACTAGCCACTGATCATGGGACTAGTACAGTGTACGCTCCAGGTATTCGGGAATTCAATCCCCGGGTG
CCGACATGTATTGCCGTAATTGTTGTGTACACGATGTAAACTGTTT