Detailed information on CNT30690295


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004039, E-value = 2e-62

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30100044Oryza sativaOryza rufipogon10080.92100861forward
CNT30575058Oryza sativaOryza barthii95.1210099.02819forward
CNT30115695Oryza sativaOryza nivara96.0585.6198.67827forward

Expression of CNT30690295

Peptides detected in this lncRNA

>peptide 1 (67 aa)
MPSKSSFDSILFRPLQRRERDLVYGSSGARSKRRRSRHRRRSERCRPSQAEPSRQRLLLEVLLKTPQ*

>peptide 2 (70 aa)
MAQQVRRSATVFFTSGCRRHCRFRLLRSSSRSSRRRSPAEGRRRREDARAVAVTKTPEKFNLTRGFRFSL*

>peptide 3 (71 aa)
LALFSASLSRHSSLSTPKPKKPRERAPTLPLHLSFVVGRRKGGRRRSPTSRLHPYLIHVLLSSLHAEQILF*

Sequence

>CNT30690295
TTCTCGCTCTCTTCTCCGCCAGTCTGAGTCGCCATTCTTCACTGTCCACCCCTAAGCCGAAGAAACCCAGGGAGAGAGCTCCAACTCTCCCTCTCCACCT
CTCTTTCGTCGTCGGCCGCCGAAAAGGGGGACGCCGCCGATCGCCAACGAGTCGTCTCCATCCCTATCTGATTCACGTTCTATTATCTTCTCTCCATGCC
GAGCAAATCCTCTTTTGACTCCATCTTGTTTCGTCCACTGCAGCGACGGGAACGCGACCTCGTCTACGGGAGCTCTGGAGCGCGCTCCAAGCGCCGCCGC
AGCCGACATCGTCGCCGTTCCGAGCGCTGTAGACCGAGCCAAGCCGAGCCGTCACGCCAACGCCTTCTCCTTGAAGTCCTCCTCAAAACCCCTCAATAAT
CCCAGGCAATGGCGCAGCAAGTGCGGAGATCGGCCACCGTCTTCTTCACCTCCGGTTGCCGTCGCCATTGTCGTTTCCGCCTCCTCCGCTCGTCGTCCCG
TTCGAGCCGTCGCCGTTCACCCGCAGAAGGACGCCGTCGCCGGGAGGATGCGCGAGCCGTTGCTGTCACCAAGACCCCGGAAAAGTTCAACCTAACCCGC
GGTTTTAGATTTAGTCTTTGAGTGATGCGGGTAATCGACTGTTTCTTCTAGGACTTGAACTTAATGGGGTAAACCCCTAGTCGGTGTGCTTGTGGATTGG
GTAGACAAGCTTCCGTTGTTCTCTCATGTGTCTATTTGGCCGGTCGGCCTATGTAATTATTAAGTTGTTGTAAGTCTTAAGTTTCTTTCATCTTAGTTGT
GTTTGCTATGTATAATCATGCTTAAGATGAAAGTGTGGATCTAGTGCACATCCTAAGAATT