Detailed information on CNT30690133


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000057, E-value = 2e-126

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3099497Oryza sativaOryza rufipogon99.5792.4799.85688forward
CNT30575074Oryza sativaOryza barthii90.7499.0599.68627forward

Expression of CNT30690133

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MGSQGKVLPHLMLNGCLTSCGNLHLHNHS*

>peptide 2 (35 aa)
HTFLKFCRFCASMMTWLLSKFKTVTFSLHQFFGSF*

>peptide 3 (47 aa)
MEKSGPCFLFHHLQMYHSPLLQLDPLLTCLKYCESQLHNLSEAPPYK*

Sequence

>CNT30690133
CCATACTTTCCTTAAGTTCTGTCGATTTTGTGCCTCTATGATGACCTGGCTTCTTTCGAAGTTTAAAACTGTCACCTTTTCTCTCCATCAATTCTTTGGC
AGCTTTTAACCGAGCTTCAGCAAACTCCATTGCTTCTTTGATAGCAGCAGCAGCAGCAGCTGAGTTAGTACTGACTTCAGAATCTCCATTTGCTTTACTT
TCCTTTTTATTAAGCAATTTGGATGGTGGCTGTACTTTGATGGGTTGTGTGTGAAGGCTGTTATTTGGGACCCTTAAGAATGGGTAGTCAGGGGAAGGTA
CTTCCTCACTTGATGCTGAATGGGTGCTTAACCTCTTGTGGTAATCTTCATCTTCACAATCATTCTTAGAAATTGGATGACATATTGGTGTGTGCAGGTT
CTGATCAGCCACAGAATCACTACTAGCACTCTTCAGGCTTGAACTTGATGGAAAAGTCAGGCCCATGCTTCCTTTTTCACCATTTGCAAATGTATCACAG
TCCACTACTACAACTTGATCCATTGCTGACTTGTTTGAAATATTGCGAGAGTCAACTACATAACTTATCGGAGGCTCCACCATACAAGTAGTCATTTTAA
CTATATCATCTGGTCTTCCCCTGGTAGCCTTGTTATATGACATACTAAACTGTTTCCCACTATCCGGAGGAGAGGAGATTGGAGAAAATTC