Detailed information on CNT30689880


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552366Oryza sativaOryza glaberrima39.920.9498.36304reverse complement
CNT30110518Oryza sativaOryza longistaminata87.855.8490.58669reverse complement

Expression of CNT30689880

Peptides detected in this lncRNA

>peptide 1 (53 aa)
QSYVSHSYDAFLLLLFDRLYMPLKSEQMHLVFLQLNIPLHKSKTIYYPLIKSC*

>peptide 2 (72 aa)
MRRIMVFQSYQMSLRFLLMPPLHWFCYLSSFAPKFLGMPLGPSALALALGLPCRYSSYSSKEIRSSSTIHKS*

Sequence

>CNT30689880
GCAAAGTTATGTATCACACAGCTATGACGCATTTCTTTTGCTGCTCTTTGACAGGTTATACATGCCTCTAAAATCAGAGCAGATGCATCTGGTCTTCTTA
CAACTCAACATCCCCCTACATAAAAGCAAAACCATATACTATCCGTTAATAAAGAGCTGTTAAAGATGGTAAAAATACATGTGCAAATCTGTTGTTCAAT
ACATGAAAAAGATAATGACACAAGGATGATGATTCTTTCAGAAGTATATTAAAATTTACCAACTCTTTCCATTATACTTGCACTTTAAAGGAACCTGCTA
TTCCTATTCATTTTGACCAAAAAAAAAAAAACGAGAACAAGCCAATGATTGGCCCATCGTTTGTATAAGTAAAGATTGATTTACAATCTGCAACTCCATC
ACTCAGAAGAACAGCATTTAACCACCTATTACATAGTACAAATTTTAAAATTAGAATATTTTTTATGAGACGCATTATGGTATTTCAAAGTTACCAAATG
TCCTTAAGATTTCTCCTAATGCCTCCTCTACACTGGTTCTGCTACCTTTCTTCGTTTGCTCCTAAGTTTCTAGGAATGCCTCTAGGCCCTAGTGCTCTGG
CCTTGGCCCTTGGGTTGCCATGCCGCTATTCATCCTATTCATCAAAAGAGATAAGGTCATCATCAACAATTCATAAGAGTTGAACATTACAAGATGCTCT
CAAGGGTTCGGCAATAAGTCAAAGCACGGAAACTAACTACTATCAACCAGAGCATATTCTCA