Detailed information on CNT30683972


BLAST search results

BLAST vs Swiss-Prot:
sp|P00228|FER_WHEAT, E-value = 1e-38

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695489Triticum urartuOryza sativa30.9128.990.14213forward
CNT30675769Triticum urartuSetaria viridis27.5830.5592.11190forward
CNT30523259Triticum urartuSetaria italica17.5622.8790.91121forward
CNT30398830Triticum urartuTriticum turgidum73.7370.36100508forward
CNT30591745Triticum urartuMusa acuminata15.0923.1686.54104forward
CNT30670012Triticum urartuTriticum dicoccoides75.6276.7395.2521forward
CNT30469592Triticum urartuSaccharum spontaneum16.6925.0590.43115forward
CNT3011815Triticum urartuZea mays31.6426.0585.32218forward
CNT30351011Triticum urartuEragrostis tef17.7120.1387.7122forward
CNT30596741Triticum urartuOryza meridionalis30.9126.4391.08213forward
CNT30370929Triticum urartuOryza glumipatula30.9127.7790.14213forward
CNT30103152Triticum urartuOryza rufipogon30.9125.5490.14213forward
CNT30584428Triticum urartuEchinochloa crusgalli34.8323.0588.33240forward
CNT30117400Triticum urartuOryza nivara30.9124.5790.14213forward

Expression of CNT30683972

Peptides detected in this lncRNA

>peptide 1 (32 aa)
PQPSGFISVRRVTYKVHASITTVVRISYGTKR*

Sequence

>CNT30683972
GCCTCAGCCATCAGGATTCATTTCAGTACGTCGAGTTACGTACAAGGTACACGCTAGTATTACGACAGTAGTACGTATATCTTACGGTACAAAAAGGTAG
TAATTCGAAGACAATATTACTTGAGCAAACCATGCATCGAGCAATTCATTCGAGCACAAAACAATCGGTGTATCGATCTGGCGATGTCCATGCATGCATG
ATACTGTAGGAGATAATATGATATCAGCTCGATCCTCTTGCAAAGAGAGATAGGTATGGCAGCTTATGCGGTGAGCTCCTCCTCCTTGTGGGTCTCGATG
ACGATGTCGGACTTGGGGTAGGCGTGGCAGGTGAGCACCCACCCTGCCTCCATCTGGTCGTCGTCGAGGAAGCTCTGGTCGGACTGGTCGATCCCCTCCT
CCTCGGCCTGGTCGAGGATGTAGACGTCGTCGGGGACCTCCAGCTCCACCTCGCCCTCGGGCGTCACCAGCTTCACCTTGTACGTCGCCTGCGCGCGGAG
CCTGGCTCCCCGCACCTGCTTGGCGGCGGCGAGGCTGAGGGCCGCGGGCGCGAGGGCCACGCGGGGCGCCGGTGGCGCGACGGCGCGCAGGGAGAAGGGC
GCGCGGAGGCTCAGTGCGGCGGCCATTGCAAGCTAGCTGGAGCTTAGACGCTCTTTCTCTGTGTGGCTGGGGAGCTGGAGAGGATAGGC