Detailed information on CNT306806


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT306806

Peptides detected in this lncRNA

>peptide 1 (50 aa)
MPSGLRASSGLRVAEPPCATVGCSRDIQASVPTSLEAGSSVCGWDRTTAA*

>peptide 2 (99 aa)
MLMHRPQQEFPHALRPPCILWVAGCGASLRDGGLQPRHPGVRSDEPRGGEQRMRVGSDDGGIIGVGAGGRSSWPARTGGGEAGGDGFGARSRSGTVVWDQ

>peptide 3 (82 aa)
LSADLVPHILDPREVMTPSSHGSIGDWPSMGCDRAPCRRWARGWGGREWGDGEPNLLTHSTNHGQWQGQGHRHCAGACALMA*

>peptide 4 (60 aa)
MRPGSMSPLGQGVGREGMGRWRTKSTHSLNQPRTVARARSPPLCWCLCTDGVTSNEGSRG*

>peptide 5 (59 aa)
MDPLEIGPPWDATGLHVAAGPGGGEGGNGEMENQIYSLTQPTTDSGKGKVTAIVLVLVH*

Sequence

>CNT306806
CTCTCCGCTGATTTAGTGCCTCATATCTTGGATCCTCGAGAGGTGATGACACCTTCAAGCCATGGATCCATTGGAGATTGGCCCTCCATGGGATGCGACC
GGGCTCCATGTCGCCGCTGGGCCAGGGGGTGGGGAGGGAGGGAATGGGGAGATGGAGAACCAAATCTACTCACTCACTCAACCAACCACGGACAGTGGCA
AGGGCAAGGTCACCGCCATTGTGCTGGTGCTTGTGCACTGATGGCGTGACATCGAACGAAGGAAGCAGAGGGTGAGATTCAGAGAAGGAAAAAGGGGTAC
TGGCTCAATCTGGGGGTAGGGATTGGGATGGCGGCGGTGTACCTTGAAGAAGATGTTGATGCATAGACCTCAACAAGAATTCCCCCATGCCCTCCGGCCT
CCGTGCATCCTCTGGGTTGCGGGTTGCGGAGCCTCCCTGCGCGACGGTGGGTTGCAGCCGCGACATCCAGGCGTCCGTTCCGACGAGCCTCGAGGCGGGG
AGCAGCGTATGCGGGTGGGATCGGACGACGGCGGCATAATCGGGGTAGGGGCAGGGGGGCGGAGTTCGTGGCCAGCCAGAACCGGGGGAGGGGAGGCCGG
GGGCGACGGTTTCGGGGCGCGATCTAGGAGCGGCACCGTTGTGTGGGATCAG