Detailed information on CNT30646295


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONBNAT004661, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3062651Cannabis sativaArabidopsis lyrata73.4675.8495.56631reverse complement
CNT30136319Cannabis sativaLolium perenne49.3674.5293.16424reverse complement
CNT30126841Cannabis sativaCorymbia citriodora39.791.6792.67341forward
CNT30363927Cannabis sativaSorghum bicolor40.7586.8589.14350forward

Expression of CNT30646295

Peptides detected in this lncRNA

>peptide 1 (59 aa)
MPLEPKASWFSPKCVEAQQLCGNLGVKHYFGARRESGTKSRQTPDTRYDLKITGVKVGQ*

>peptide 2 (32 aa)
KEPPSGSEIEHETVSSQVVGGAQGSDRVPIEE*

Sequence

>CNT30646295
AAAGAACCCCCATCGGGGAGTGAAATAGAACATGAAACCGTAAGCTCTCAAGTAGTGGGAGGAGCCCAGGGCTCTGACCGCGTGCCTATTGAAGAATGAG
CCGGCGACTCATAGGCAGTGGCTTGGTTAAGGGAACCCACTGGAGCTGTAGCGAAAGCGAGTCTCCATAGGGAAATCGTCACTACTTATGGACCCGAACC
TGGGTGATCTATCCATGACCAGGATGAAGCTTGGGTGAAACTAAGTGGAGGTCTGAACCGACTGATGTTGAAGAATCAACGGATGAGTTGTGGTTAGGGG
TGAAATGCCACTCGAACCCAAAGCTAGCTGGTTCTCCCCGAAATGCGTTGAGGCGCAGCAGTTGTGTGGAAATCTAGGGGTAAAGCACTATTTCGGTGCG
CGCCGCGAGAGCGGTACCAAATCGAGGCAAACTCCGGACACTAGATATGACCTCAAAATAACAGGGGTCAAGGTCGGCCAGTGAGACGGTGGGGGATAAG
CTTCATTGTCGAGAGGGAAACAGCCCGGATCACCAGCTAAGGCCCCTAAATGACCGCTCAGTGATATAGGAGGTAGGGGTGCAGAGACAGCCAGGAGGTT
TGCCTAGAAGCAGCCACCCTTGAAAGAGTGCGTAATAGCTCACTGATCGAGCGCTCTTGTGCCGAAGATGAACGGGGCTAAGCAATCTGCCGAAGCTGCG
TGGGATGTAAAAATGCATCGGTAGGGGGGCGTTCGCCTAGAGGGAAGCACTGCCGAAAGCGATGGTAGAGGTTTAAAGCGAGAATGTCGGCTTGAGTAAT
GCAAACATTGGTGAGAATCAAATTCCCCAAAAACCTAAGGGTTCCTCTGCAAGGTTCGT