Detailed information on CNT30646148


BLAST search results

BLAST vs Swiss-Prot:
sp|P09756|CB23_SOYBN, E-value = 6e-45

BLAST vs NONCODE:
NONMTRT001605, E-value = 3e-44

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30514354Cannabis sativaJuglans regia47.7936.6583.59195forward
CNT30404250Cannabis sativaBeta vulgaris63.7325.3485260forward
CNT30507213Cannabis sativaNicotiana attenuata47.346.3986.01193forward
CNT30709869Cannabis sativaGlycine max61.0341.7185.94249forward
CNT3046345Cannabis sativaPrunus dulcis47.7939.7184.1195forward
CNT3092178Cannabis sativaSolanum tuberosum60.2927.1886.18246forward
CNT30173252Cannabis sativaTrifolium pratense48.2826.3786.29197forward
CNT30610017Cannabis sativaGossypium raimondii61.5276.5288.05251forward
CNT30202642Cannabis sativaHelianthus annuus55.1540.3984.44225forward
CNT30359114Cannabis sativaLactuca sativa61.2744.0986250forward
CNT30423795Cannabis sativaPapaver somniferum27.731.0489.38113forward

Expression of CNT30646148

Peptides detected in this lncRNA

>peptide 1 (62 aa)
RQDSQYDFSFIDSQHIYIITKQRKDKTHNITNMNNTNSSLSLILSLFLFLNSSLSRDKVGSI*

>peptide 2 (33 aa)
HDKIHNMIFHSLILNTFTSSPNKEKIKPITLPI*

Sequence

>CNT30646148
CACGACAAGATTCACAATATGATTTTTCATTCATTGATTCTCAACACATTTACATCATCACCAAACAAAGAAAAGATAAAACCCATAACATTACCAATAT
GAACAATACAAACTCTTCTCTTTCTCTCATTCTCTCTCTCTTTCTCTTCCTAAACTCTTCACTTTCCAGGGACAAAGTTGGTAGCATATGACCAAGCATT
GTTGTTGACTGGGTCAGCAAGGCCCAATGGGTCAAAACTACCACCTGGGTAGATTGGGTCAGTGACCTCACCAAGAGGCCCACCGGCAATACGGTAACCC
TCAACAGCTCCCATTAAGATCACTTGAGTGGCCCAAATAGCCAAGATGCTCTGAGCATGGACCAAACTTGGGTTACCCAAATAGTCAAGCCCACCTTCAC
TGAAGATT