Detailed information on CNT30644842


BLAST search results

BLAST vs Swiss-Prot:
sp|Q03033|EF1A_WHEAT, E-value = 1e-50

BLAST vs NONCODE:
NONBNAT007048, E-value = 2e-70

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673325Cannabis sativaSetaria viridis59.944.4984.71242forward
CNT30316757Cannabis sativaCorylus avellana56.9319.290.87230forward
CNT30518292Cannabis sativaJuglans regia61.3954.0386.29248forward
CNT30618428Cannabis sativaSesamum indicum38.8631.8585.99157forward
CNT3020493Cannabis sativaCitrullus lanatus38.8610.1788.54157forward
CNT30630601Cannabis sativaVigna unguiculata52.7229.7988.26213forward
CNT30194937Cannabis sativaPisum sativum57.6723.3290.56233forward
CNT30503993Cannabis sativaNicotiana attenuata40.5959.6487.2164forward
CNT30637620Cannabis sativaCapsicum annuum10021.0488.37404forward
CNT30287202Cannabis sativaTriticum aestivum59.933.6685.95242forward
CNT30224866Cannabis sativaHordeum vulgare30.695088.71124forward
CNT30234068Cannabis sativaBrassica oleracea58.1749.7988.94235forward
CNT30146188Cannabis sativaMedicago truncatula57.6729.6888.84233forward
CNT30440628Cannabis sativaAegilops tauschii59.1632.5686.61239forward
CNT3076676Cannabis sativaBrassica juncea61.1421.6988.26247forward
CNT3015474Cannabis sativaZea mays54.738.4385.97221forward
CNT30355521Cannabis sativaLactuca sativa57.4324.3290.09232forward
CNT30151899Cannabis sativaPrunus persica38.8614.2387.9157forward
CNT3052962Cannabis sativaAmborella trichopoda43.5621.6585.23176forward
CNT3024873Cannabis sativaPopulus trichocarpa60.8943.6285.77246forward
CNT3037774Cannabis sativaCucumis melo48.5125.3689.29196forward
CNT30147611Cannabis sativaBrachypodium distachyon38.8626.1785.35157forward
CNT30101053Cannabis sativaOryza rufipogon59.929.1286.36242forward
CNT30580076Cannabis sativaEchinochloa crusgalli60.6418.5286.94245forward
CNT30594546Cannabis sativaEragrostis curvula60.6451.887.76245forward
CNT30726329Cannabis sativaLupinus angustifolius57.1850.4489.18231forward

Expression of CNT30644842

Peptides detected in this lncRNA

>peptide 1 (59 aa)
GYSAKVSTTMGLVGTILTIPASPFFKNFGSFSSSLPDLRSILVRISENLTAMWETEWLV*

>peptide 2 (43 aa)
WVLSEGFNHHGLGWNHLNHTCITILQELWFLLELLTRPTVNLG*

>peptide 3 (33 aa)
MGFCQGCTQPSSSRKRLPSRFPHTWPWSIWVWWH

Sequence

>CNT30644842
GTGGGTACTCAGCGAAGGTTTCAACCACCATGGGCTTGGTTGGAACCATCTTAACCATACCTGCATCACCATTCTTCAAGAACTTTGGTTCCTTCTCGAG
CTCCTTACCAGACCTACGGTCAATCTTGGTTAGGATTTCAGAAAACTTGACAGCAATGTGGGAGACGGAGTGGCTTGTCTGAGGGTCTCTTGGGCTCAGA
GAGATTGTCAAGAGCTTCAAGAAGAGTTGGACCCTTGTACCAGTCAAGGTTGGTAGACCTCTCAATCATGTTGTCTCCTTCGAAACCAGAGATGGGAACG
AATGGGATTTTGTCAGGGTTGTACCCAACCTTCTTCAAGTAGGAAGAGACTTCCTTCACGATTTCCTCATACCTGGCCTTGGAGTATTTGGGTGTGGTGG
CATC