Detailed information on CNT30643391


BLAST search results

BLAST vs Swiss-Prot:
sp|Q09WW0|TI214_MORIN, E-value = 1e-84

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30643391

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MLWGLHIPIIAVIIQIEKYFFINRKKISYVSI*

>peptide 2 (59 aa)
MTENPDVIFQYKMKRKFLDIRIRYFKIQSIEGVDPIQTKKEKEGFLLGKGLNKTRFKIQV

>peptide 3 (35 aa)
MPPLFYCSFIRNSTCQALSKFLVYIFNLFQKNCKN*

>peptide 4 (98 aa)
MLIDDSSIISLLNIKFFSFFFLLNSYISTSFSFKKIRFIFESSFIIFFFKKECFDFIFSPYPMEENAPSFLLQLYSEQHLPGFIKISRLYIQSIPEKL*

Sequence

>CNT30643391
TTTTTTAGTTTGAATCAAATTTCTTGAAATGTTTATTTTGAACTATAGAGTTTTTCTTTACTATATTTCGCGATTTTGGGGGTATTAATTTAGACTGAGA
TAAATCATATTGATAATAACCCTTTAACCAATTTTTCTATTGATTTATTCCATAATTGCTAGGGTTTCTATGTCTTAATTCGGAATTAAAAATTTCCTGC
GTTCCAACAAAATAATCCTTTATTCCATTCTTAAGAAAAAAAGATGTTTCCTTATATTGATATTGAAAGACAGATCTTAATTTTGACTTATATAAATTAA
AAAAATGAAAAAAGGGGGGTTGTGATAATTTATAAAAGACATATGCTTGTGACAAATAAGATAAGTCATAAAAAGTCTGTGACTTATTAAGATTAGAAAT
TGATTTTTTTATAGTCGAAATAAACTGAGTTATATTTGGATTTGTTTCGTTAGTCGAAATAGGGTTTTTATAGGAACTGTATTTATTAAGAATTTTTTTT
GTTGATTCAAAAAAATAGAAAAAAACTTGTACATTTATTCTAGGAATATTACTGATAAATAGAAATATATTTATAGATATCCTTTGAATTAAAAGTTGAA
AAAAAAAAAAGGATTTACGGATTAGTCGAGCCTTTCTTCTTTTTAATTTTAATGTCTGAAAAATCTTTTTTGGAAATTTCAATCTTTCATCAGCATAACT
TATTTCGTTAAAACTAAAAATTTTTTGTGGGTTTATAAATCCTCTTTTGTTGTCTTTTGGAATTTTTTGTATTTGATTTATGATTGTATTTGTTTTATTA
GTTAGATCTTGTTTTTTTTTTTTAAAATGAAAAGGTTGTCCAATTCGTCGATTCAATGTTAATCGATGATTCGTCCATTATCTCATTATTAAATATCAAA
TTTTTTTCTTTTTTTTTTTTACTCAATTCATATATTTCGACTTCTTTCTCTTTCAAGAAAATTAGGTTTATTTTTGAGAGTTCTTTTATTATTTTTTTTT
TTAAAAAAGAATGCTTTGATTTCATATTTAGTCCATATCCAATGGAAGAGAATGCCCCCTCTTTTCTATTGCAGCTTTATTCGGAACAGCACCTGCCAGG
CTTTATCAAAATTTCTCGTTTATATATTCAATCTATTCCAGAAAAATTGTAAAAATTGAAGTGAAGCGCGAGAATTTACTGAAAATTACCTATAGACTCA
TATACAGATAAGATATTGGATTAGATAATATTTGTGTAATAAGTTATGTTATGGGGTTTACATATACCCATAATTGCTGTTATAATTCAAATTGAGAAAT
ATTTTTTTATTAACAGAAAAAAAATTAGTTATGTATCCATTTGAATTTTCTTATATCATTAGGGAAACACAATTTTAGATTCAAATTCACGAATCGTTTA
TGAATTCACAATCAATAGTTAACGGTTCAAATTTGTCCTGAATTTTTGCTTTTATGACCGAAAACCCAGATGTGATTTTTCAATATAAAATGAAAAGAAA
GTTTTTAGATATTCGAATTCGATATTTTAAGATACAATCAATCGAAGGGGTGGATCCAATCCAAACAAAAAAAGAAAAGGAAGGATTTCTTTTAGGAAAG
GGATTAAACAAAACGAGATTCAAAATACAAGTAC