Detailed information on CNT30642274


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONMEST004927, E-value = 2e-43

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678637Cannabis sativaSetaria viridis39.5379.5690.71323forward
CNT30524663Cannabis sativaSetaria italica50.5570.9684.5413reverse complement
CNT30641718Cannabis sativaNymphaea colorata51.657890.76422reverse complement
CNT30549212Cannabis sativaIpomoea triloba99.8827.0593.01816reverse complement
CNT30270599Cannabis sativaChenopodium quinoa9447.1791.28768reverse complement
CNT30730494Cannabis sativaCorchorus capsularis98.7891.793.68807reverse complement
CNT30494210Cannabis sativaOlea europaea25.838.6481.04211forward
CNT30220355Cannabis sativaHordeum vulgare34.8895.3291.58285reverse complement
CNT30396824Cannabis sativaTriticum turgidum85.869.6188.02701forward
CNT30569398Cannabis sativaActinidia chinensis76.531.9992.64625reverse complement
CNT30511593Cannabis sativaSolanum lycopersicum19.9525.0488.34163reverse complement
CNT30552690Cannabis sativaOryza glaberrima70.7537.7591.7578reverse complement
CNT30442196Cannabis sativaAegilops tauschii70.7568.1692.73578forward
CNT30657980Cannabis sativaTriticum dicoccoides43.9487.9990.81359forward
CNT30207763Cannabis sativaHelianthus annuus95.3584.0393.71779reverse complement
CNT30688674Cannabis sativaTriticum urartu92.7857.5688.79758reverse complement
CNT30720843Cannabis sativaTriticum spelta6.1223.269650reverse complement
CNT30347837Cannabis sativaEragrostis tef45.5348.2591.4372forward
CNT30363261Cannabis sativaSorghum bicolor48.3531.0383.8395reverse complement
CNT30620564Cannabis sativaCajanus cajan86.5413.6693.35707forward
CNT30354697Cannabis sativaLactuca sativa42.5949.2995.11348reverse complement
CNT30481523Cannabis sativaChara braunii8.0827.592.4266forward
CNT30410483Cannabis sativaPapaver somniferum99.2739.6493.34811reverse complement
CNT3036965Cannabis sativaCucumis melo82.6292.7293.48675reverse complement
CNT30331560Cannabis sativaDioscorea rotundata39.5363.9687.31323forward
CNT30150154Cannabis sativaBrachypodium distachyon70.7550.5292.04578reverse complement
CNT30104374Cannabis sativaOryza rufipogon70.7543.5291.52578forward
CNT30576813Cannabis sativaOryza barthii23.526.0592.71192reverse complement
CNT30581628Cannabis sativaEchinochloa crusgalli13.8333.0491.15113reverse complement
CNT30604015Cannabis sativaOryza punctata5389.6587.76433forward
CNT30174498Cannabis sativaVigna angularis48.8479.0190.73399reverse complement
CNT30551087Cannabis sativaOryza brachyantha16.2844.6393.98133forward
CNT30115272Cannabis sativaEutrema salsugineum25.3442.5986.47207reverse complement

Expression of CNT30642274

Peptides detected in this lncRNA

>peptide 1 (47 aa)
ELIGSYRNKVQVHRSVRMPQLHTSLHFRLTPIVMINGSSHRDLLLNS*

>peptide 2 (37 aa)
MDRTIAWRSEPSSCTALMGEQPNPWNILQPQVAKSRH*

>peptide 3 (34 aa)
MLSVVIRSALGYPAFYRGHDNWYTRGASFPVLSY*

Sequence

>CNT30642274
TCGAATTGATCGGGTCATATAGGAACAAGGTTCAAGTCCACCGATCTGTTAGGATGCCTCAGCTGCATACATCACTGCACTTTCGCTTGACACCTATCGT
AATGATAAACGGCTCCTCTCACCGTGACCTTCTCTTGAATTCTTAAAACTTCTGTCGCTCCACCCCCGCAGAGGCAGAAAACCCATTATTGTCTTGGTTG
TGCTACCAAAGACTCTGGGGAAGTCGGAATTGGAGAGCACTCATCTTGGGGTGGGATTACTACTTAGATGCTTTCAGTAGTTATCCGCTCCGCACTTGGA
TACCCAGCGTTTTATCGTGGGCACGATAACTGGTACACCAGAGGTGCGTCCTTCCCGGTCCTCTCGTATTAGGGAAAGGTCCTCTCAATGCTCTAGCGCC
CACACCGGATATGGACCGAACTATCGCATGGCGTTCTGAACCCAGCTCATGTACTGCTTTAATGGGTGAACAGCCAAACCCTTGGAACATACTACAACCC
CAGGTGGCGAAGAGCCGACATTGAGGTGCCAAACCTTCCCGTCGATGTGAGCTCTTGGGGAAGATCAGTCTATTATTCCTAGAGTAGCTTTTATCCGTTG
AGCGACGGCCCTTCCACTCGACACCGTCGGATCACTAAGGCCGACTTTCGTCCCTGCTCGACGGGTGGGTCTTGCAGTCAAGCTCCCTTCTGCCTTTGCA
CTCGAGGGCCAATCTCTGTTTGGCCCAAGGAAACCTTTGCACGCCTTTGTTACCTTTTGGGAGGCCTACGCCCCATAGAAACTGTCTACCTGAGACTGTC
CCTTGGCCCGTACTCCC