Detailed information on CNT30614223


BLAST search results

BLAST vs Swiss-Prot:
sp|O50055|COL1_ARATH, E-value = 1e-37

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30377462Arabis alpinaArabidopsis thaliana44.347.4885.28231forward
CNT30311097Arabis alpinaCamelina sativa41.8446.7885.78218forward
CNT3061753Arabis alpinaArabidopsis lyrata47.226.9485.37246forward
CNT3079004Arabis alpinaBrassica juncea23.4212.3186.07122forward

Expression of CNT30614223

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MKEQFHILCQTLSLWRKDSSLSVHWTKHLSWRFK*

Sequence

>CNT30614223
GTAATTTACAAGCAAGCAATCTGGTTTTGCTATAGGAACATATCAGAATGAAGGAACAATTCCATATCCTGTGTCAAACATTATCATTGTGGAGAAAGGA
CTCTAGCCTCTCTGTCCATTGGACTAAGCACCTGAGTTGGAGGTTCAAGTAGTTGGTCTGCTACCGCTTTGGGCGATCTTGGGTGTGAAGCTGTTATGTC
GCTCGTTGGTGACTCTGGCACAACTCCGATATGACTTAAGGAACCAATGGAGCTTTGATGAGCTCCTGAGGAGCCATGGGCAAAACCGAACTGAAAGTCG
TGTTGCTCATGGTGCATGTGACCCTTTAATTCTTCAACTTGAAGTGGAACAACTCCATCTCCCCCATAGCTCCTCTGAGGCAACAACCAAGAAGCCGCCT
CTGCTTCATCTTCCTCCTCTTCTTGACTCACGACCAGTCTGTTCTCTGGATCTGTCGTCACTGTTGTCTCACTTGAATGGTTATTCGGCATGGAACTGTA
AGAGTTTCCAGAAATTGGCAG