Detailed information on CNT30614172


BLAST search results

BLAST vs Swiss-Prot:
sp|P50375|EFTU_DERMA, E-value = 4e-06

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672978Arabis alpinaSetaria viridis61.679.2885.55616forward
CNT30629687Arabis alpinaVigna unguiculata30.915.6587.38309forward
CNT30712080Arabis alpinaGlycine max3446.9684.12340forward
CNT30598015Arabis alpinaFraxinus excelsior50.199.885.83501forward
CNT3015747Arabis alpinaZea mays70.999.384.91709forward
CNT30101006Arabis alpinaOryza rufipogon38.355.0385.12383forward
CNT30580076Arabis alpinaEchinochloa crusgalli63.447.9286.12634forward

Expression of CNT30614172

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MMMTWEVKLAAPLAGSSLEFETHGASQQT*

>peptide 2 (54 aa)
MVHLNRLNLSGQPCRSKGHNHTRLDHTSLNTSHWHRSNTTNLVNILKGKTEGLV*

>peptide 3 (62 aa)
MSLTAKRPNGGYSMKVSTTIGLVGVILTIPASPFFKNLGSFSISLPERLSILVKISVNLTAM*

Sequence

>CNT30614172
ACTCGCAAAGAAACTCTAAAAAGCAAAATTATCCAGAAACTGCATAATTGAAAACCATAATAAGTCTCAGAGGTATCCAAAAAGGAGGTAGAGAGAAGAA
ATGTCGCAGAAAATAAAAGAAAAAAGAGGCTCAAACGCCATTAAAGTTTCAAACCAAAGAAAACCATAACAGAGTCGATCATAACGAAAGTCTCATCATT
TAGCTCCCTTCTTCACTGCAGCCTTGGTCACCTTGGCTCCGGTTGGGTCCTTCTTGTCCACACTCTTGATAACACCAACAGCAACAGTCTGCCTCATGTC
CCTAACAGCGAAACGACCCAATGGAGGGTACTCCATGAAGGTCTCAACAACCATAGGCTTGGTTGGAGTCATCTTAACCATACCAGCATCACCATTCTTC
AAGAACTTAGGCTCCTTCTCGATCTCCTTACCAGAACGCCTGTCAATCTTGGTCAAGATCTCAGTGAACTTGACTGCAATGTGAGAGGTGTGGCAATCGA
GAACTGGGGCGTAACCGTTACCGATCTGACCAGGGTGGTTCATGATGATGACCTGGGAGGTGAAGTTAGCAGCACCCTTAGCTGGATCATCCTTGGAGTT
TGAGACTCATGGTGCATCTCAACAGACTTAACCTCAGTGGTCAACCCTGTAGGAGCAAAGGTCACAACCATACCAGGCTTGATCATACCAGTCTCAACAC
GTCCCACTGGCACCGTTCCAATACCACCAATCTTGTAAACATCCTGAAGGGGAAGACGGAGGGGCTTGTCTGATGGCCTCTTTGGCTCGTTGATAGCATC
AAGAGCCTCAAGGAGAGTTGGTCCCTTGTACCAGTCAAGGTTGGTGGACCTCTCAATCATGTTGTCTCCCTCAAAACCAGAGATAGGAACGAATGGGATT
TTGTCAGGGTTGTATCCAACCTTCTTCAGGTAAGAAGACACCTCCTTAACAATTTCATCGTACCTACCCTTGGAGTACTTGGGGGTAGTAGCATCCATCT